Loading...
HomeMy WebLinkAboutOC1968-0663 - ESTATE OF KNOXFORM 67 REV.1-50 REG.WILLS 1\ppltration for 14ttttra of 1\lttttiuialration on tht Estate of..E.L.IZA;S.E.'IH..:£..~~al.kl..g MES..,:I'.HQ.s..r.E.r.KN.QX...QI'MRS..Il••••:r.HQMAS E.KNQ.z p 1:V~:ftrtCi . Iate ,of......J?1!.~J.sJ:.Q r..Qw.n.?.hJp..l W9:.?..hJng.t.9..n ~.Q:g,D.!:y..,~nDe~lased. Before the Register of Wills of Washington County personally appeared.....The.Qdo.r.e....M......S.tineELTZ·ABETH....S·~..·~~~....;3:;t1e1Ci....MRS·:·TIrOS..:E • who,being duly sworn deposes and says that..KN.QX or MRS 'rHOMAS E.KNOx.. age ??..,having ~.~~..last family or principal residence at ~..~p..:.J.~. (Street and Number) N.?~.hJ.n.g..l;:.Q.n t~YJ.f.9:JQ ';r.Q.w.XH?..h,.i..p..L ,Washington County,Pennsylvania,died intestate (City,Borough,Township) at.her .r.e.sidenc:.e ,on the..2.5 day of Apr.i.l . A.D.,19..~..?,at...3...:..g..~;~.~M.,possessed ofpetsonaI estate to the estimated value $5..Q.~.Q.Oi.Q.....O.Q ,and of real estate in the Commonwealth of ',Pe~nsylvania to the estimated value of $.~..?..I..Q.Q:Q.1..Q.Q ,situ ate in J?1t.f..f.slQ T..QX?n?..h!p..l W9:.§hJng.t..QD S;.9..RQ..t.y..1.f.l.g.D:n~..~. ...................................................................................................................................................................................................................................................' :The names and addresses of the decedent's surviving spouse'(if any)and other heirs including heirs by adoption)are as follows. REI,ATIONSHIP RESIDENCE .................................................................................................:,~,.. William P.stine brother .Oakmont,Pennsylvania Sworn and subscribed before me this !?.t.h .. ......~,~. ~h§.Q9.!?.!:§!X!.~~.t..!.~.§;g§p.h§~~:!'.~Y..!.2.E~.!:9.~~.f.?§.~g~y..!.y.?:!]J.?:. .........................................................-~"""'.'.""."."""""."""".".",..~~.. .................................................................................................................................................................................................................................................. ..............................................................................................................••.•••••.••••••.•••••••••••,•••••••••••••••••••...............................................~••••_"--••=.•••...•...•....••••••......• That deponent is over 21 years of age,resides at...::~:.~¥..~?E.~.~.?~~.!.~.:.~~.~X.~y.~.~.~.~. ...................................................................................................................................................................................................................................................' is a citizen of the United States and a resident of Pennsylvania,and respectfully applies for Letters of Administration upon the Estate of said decedent,no letters havino-been previously issued thereon. ...~~.._- ,May 68dayof,A.D.,19 .. ............t£~~L£.~?~~_. REGISTER COMMONWEALTH OF PENNSYLVANIA}SS: WASHINGTON COUNTY) ... And nOw lI4ay f;),19.6.8 ,comes Tb.eo.dar.e ,M S.tin.e .. who being duly sworn doth depose and say that..?:~will well and truly administer the goods and chattels,rIghts and credits,of J;;.l.t.;?;.?.p..§.t.h..s..,~t.in~:~,deceased, to the best oLhis....skill and judgment in strict compliance with the laws of this Commonwe~lth,mind- ful of the laws relating to inheritance taxes. Sworn and subscribed before me this §!:.h .. day of._May.,,A.D.,19 6.8..........£..~L..~z.~.. REGISTER ..~..~.~~..__. tT'."r' ,.& II f(tJ.i 97 ~<~~-tt J7~~&:1 APPLICATION FOR Letters of Administration 'ESTA~ ELIZABETH S.tiiiMj\a/k/a MRS.~HOS. E.KNOX or MRS.THOMAS E.KNOX Deceased Letters.........R $......................................................... P $....l ..::·(pO............... Extra Alias $...,. Certificates !J ....f Q $3 ..,c.......................................................... Renunciations f $1.(}C/.................................................... .;2-..............................................................a.1$(..,°0V'iJl ~. ........................................................................................................ Total..· · · ··7 ~.7~· ·.. n~· ;n ;t;:P"i:::0 C')C';:-<~~ -u)t I ~(./)~~p ~"""r r- c'- I ..,...~':>--v rn::E;;o ~ I ~CJ,0 ....... (J)iU I \. j .. ,',...SHE.BMAN....H.".....S.I'E.~~L..,.....ES.QUI.RE...... Attorney :> "-...'! I i "J., '~~~:6G~-~.tjy , ESTATE OF ELIZABETH S.STINE a/k/a MRS.THOS.E.KNOX or MRS.THOMAS E.KNOX ,................................................................................................................................................................................................................................DECEASED The undersigned NJJ.li.g..m.p...!•••..:?.t..i.n.~~!.Jsj.g w..~J?!?..t.Jn~.I.QJ.".Q.t.h.~.+.and heirs of..~.~.~.~.~.~.~~.~~..:~.!:.~.g.~late of ~.~.~.~.~.~.?~g~~.~.~.~P... deceased,hereby renounces h!.~right to administer on §.~.i.g estate and respectfully asks that Letters of Administration be issued to T..hg9..gQJ.".~M.~s..t.:i..p.~.., . ':l:.::.¥..~.?~~.~9..~E..!.:!:~.~E:~.¥..~.y..?:?:~.?.:.. Signed in the presence of: '--I.'/t·L/~.,J.d:!.k.~~!.;i;.(?;~:::..~::.."'l", ................................................................................................................... .................................................................................................................. .................................................................................................................. .................................................................................................................... ................................................................................................................... ...QI.:.....(2_......._...:...._..::...._ .~..~. ... \.-.'\'J -' :;u m Z C Z ()-~-oz )." arnt1ttttnUU1talt~of 'tnu.ayluantat~!I!I. Iht!Iqingtou Olounty,) I,Russell Marino ,Register for the Probate of Wills and Granting Letters bf Administration in and for the County of Washington,in the Commonwealth of Pennsylvania, to Theodore M.Stine admi±J.istra t or of all and singular the goods and chattels;rights,and credits,which were of Elizabeth S.Knox,A/K/A late of Washington County;deceased, Mrs.Thos.E.Knox,A/K/A Mrs.Thomas E.Knox GREETiNG: WHEREAS,the said Elizabeth S.Knox,A/K/A Mrs.Thos.E.Knox,late of A/K/A Mrs.'Thomas E.Knox in the county aforesaid,lately died intestate (as is affirmed),possessed of divers goods and chattels,rights and credits,within the said County, Ruese 11 Marino by reason.whereof the power of granting administration thereof doth belong to me;I therefore,confiding in your fidelity,do by these presents grant unto you these LETTERS OF ADMINISTRATION,here- by committing unto you full power to administer the goods and chattels,rights and credits,which were of said deceased within this Commonwealth,you having taken and subscribed the oath of office pre- scribed by law;requiring you to well and truly administer the goods and chattels,rights and credits, which were of said deceased,and to exhibit a true and perfect inventory thereof into the Register's office,at Washington,within ninety days,and to render a just and true account of your administration at the expiration of six months from the date hereof,and to regard and comply with the provisions of the laws relating to inheritance taxes. IN TESTIMONY WHEREOF,I have hereunto set my hand and caused the seal of said Office to be affixed this 6th. day of May in the year_of_our .Lord_one..thousand nine hundred and Sixty Eight ~fij~,...,!..~~. JdOOBDilil:NI!ltJtlUlOI£iGlEkKs:,xRegister. ~--------- ..;~ --.t' !f~ 1Jjettrra of ~llminiatration IN ESTATE OF _ Blizabeth s.Knox#A/K/A' ......~!'.~.~~~~.~.~.~.~~~~~.'-.~~(~. Mrs.Thomas E.Knox ~9 " I I, i '., ""1IIIIIIII 1Kuum i\111lru iy ID~rsr Jrrsruts ELIZABETH S.STINE a/k/a MRS.THOS. Estate of E;~..I<~?~...().~..~~~.~...!.I1.?~.?...~.~....~NrXNO' .....of 19..9JLlateof...B.uffalo'l'ow.nship ...,Deceased KNOW ALL MEN BY THESE PRESENTS, That we,~H~9.P.9.~JVI.~w:rJ;.~.~?nq ~~\7~~~.~,~I1\fJ:):E:~~.ITX ~<?~~.~~X... ..............,,,,,,,,. all of Washington County,Pennsylvania,are held and firmly bound unto the Commonwealth of Pennsyl- vania,for the use of those interested in the estate,in the sum of F.ifi::y :t.l1,9.l.;t.~.Cl.J;l.q Dollars,to be paid to the said Commonwealth,to which payment,well and truly to be made,we do bind ourselves, jointly and severally,for and in the whole,our heirs,executors,administrators,successors and assigns,and each and every of them,firmly by these presents.Sealed with our seals and dated the ~.tl1.day of ................May A.D.,one thousand mne hundred and~~){.t:¥.-:-:~.~<3:?:t.(1.9.p.aJ THE CONDITION OF THIS OBLIGATION IS,That if the above bounden .....THEODORE M.STINE .............................................................................................................................................................. or any of them,shall well and truly administer tO~~th'~"(~~)t ~~~e~~O~:::; ..........................................................(SEAL) ~tnttmtnt uf ~urtty obligation shall be void as I,----------------------------------------.-----------------------~---.---------------------------._...,surety in the sum of $on the administration bond in the estate of ..-----..-..--_--.._---._..___.___.____._,say that I reside at _..-_..-,.,-.-._-_-----..---.-----,Washington County,Pennsylvania;that I am the owner of real estate,the title to which is in my own name and duly recorded,situated in , Washington County,Pennsylvania,worth above all encumbrances $~;and that I am worth the amount expressed in said bond,over and above my just debts and liabilities. Administrator the estate otherwise, .~-------~--~------------~-._---~~-------~-~-~---~---~-------~~----~~-----_.~-----~------------------~-~-------._----~~ P.O.Street -----~~---------~--------------------------~-._-------_.~_.----------_._---------------------- &tnttmtnt uf ~urttl! I,--_,surety in the sum of $_on the administration bond in the estate of ------__,say that I reside at ............---..-..,Washington County,Pennsylvania;that I am the owner of real estate,the title to which is in my own name and duly recorded,situated in , Washington County,Pennsylvania,worth above all encumbrances $;and that I am worth the amount expressed in said bond,over and above my just debts and liabilities. --...._-.......,-.---.. .....-~-~_-.._..-_"-'--_~""-'"'".__---_.- ---_._---~~--------.----------------------_._-~---._--------------------------------- Street P.O. COMMONWEALTH OF PENNSYLVANIA,}.Ss·WASHINGTON COUNTY,'". And now 19 ,comes . who being duly sworn,says that he is acquainted with the financial standing of the securities to the within bond;that the said obligors have each executed the said bond and that the sureties thereto are the owners of real estate in their own right of value more than the penal sum of said bond over and above all incumbrances and exemptions. Sworn and subscribed before me this . day of _..__A.D.19 _ .._-----------------._----._--------------._------._~--------_..-._-_.--.._---~--------._-----_._------- No.~-?-7------ Abminiatratinn l8uM IN THE ESTATE OF ELIZABETH S.STINE a/k/a MRS.THOS.E.KNOX or MRS.THOMAS E.KNOX,deceased ,.._.1;c,~-....;-W ". And now _~l~.~....~_....S~~g:._.._::::.::._._,19__~.( Bond approved nCl Letters'issuecl to~~~~----~r-~r'~l <.::'>--co ~··-----·--'------··-·-~~~.-.·~-···-·-;:l------·---JCJ·,~j--~----,;,.-----_.._-.- ~.~ ~;;;"(;'). "-£J .A()~".--~._~-----_._._- Register Bond Book ------It..:L .__Page -;?/./8 SHERMJ.lli'Kl}RrNT'~]~~'Do~~9UIRE21~WASHINGT~TRUST BLDG. WASHINGTON,PENNSYLVANIA .0;: j ~~,~~ ".~-'" \. ---.J The Travelers Indemnity Company Hartford,Connecticut POWER OF ATTORNEY TO APPOINT SUBSTITUTES KNOW ALL MEN BY THESE PRESENTS: That THE TRAVELERS INDEMNITY COMPANY,a corporation of the State ot Connecticut, does hereby authorize and empower ----J.H.Kidder,Arthur S.Linn,Austin F.Schall,Raymond B.White,W.L.Waltz,Jr., all of Pittsburgh,Pennsylvania,EACH ----- Attorney-in-Fact of THE TRAVELERS INDEMNITY COMPANY,for and on behalf of the Company, to execute and deliver to any person or persons he may select,a Special Power of Attorney granting power and authority,for and on behalf of the Company as surety,to execute and deliver and affix the seal of the Comi;any ther~to,if'a seal is required,any particular bond,undertaking,recognizance,consent of surety or other written 'obligati0rl"'in the nature thereof as specifically described in each instance in such Special....(".~,..~.,.~,it,Power ofAttorney.'I'~," :"':-"?>.-.." T~is:grant of authority is made under and by authority of the following by-law of the Company which is now in full force and effect: ARTICLE IV,SECTION 12.The Chairman of the Board,the President,the Chairman of the Finance Committee, the Chairman of the Insurance Executive Committee,any Vice President,any Second Vice President,any Secretary or any Department Secretary may authorize and empower any attorney·in·fact or agent for and on behalf of the Company to execute and deliver to any person or persons he may select a special power of attorney granting power and authority for and on behalf of the Company to execute and deliver,and affix the seal of the Company thereto,any particular bond,undertaking,recognizance,consent of surety or other written obligation in the nature thereof as specifically described in each instance in each such special power of attorney;and any of said officers max revoke the power and authority of any attorney·in·fact or agent to execute or deliver such special powers of attorney... This power of attorney is signed and sealed by facsimile under and by the authority of the following Resolu- tion adopted by the Directors of THE TRAVELERS INDEMNITY COMPANY at a meeting duly called and held on the 30th day of November,1959:; VOTED:That the signature of any officer authorized by the By-Laws and the Company seal may be affixed by facsimile to any power of attorney or special power of attorney or certification of either given for the execution of any bond,undertaking,recognizance or other written obligation in the nature thereof;such signature and seal,when so used being hereby adopted by the Companyas the original signature of such officer and the original seal of the Company,to be valid and binding upon the Company with the same force and effect as though manually affixed. .. IN WITNESS WHEREOF,THE TRAVELERS INDEMNITY COMPANY has presents to be signed by its proper officer and its corporate seal to be hereunto affixed this day of July 1966 caused these 28th ·THE TRAVELERS INDEMNITY.COMPANY By ¢d.>!,I2£J ," ~ecretary,Fidelity ,and Surety -.-.-._.__.. State of.Connecticut,County of Hartford-ss: On this 28th day of July in the year 1966 before me personally came G.Roger Wheeler to me known,who,being by me duly sworn,did depose and say:that he resides in the State of Connecticut;that he is Secretary (Fidelity and Surety)of THE TRAVELERS INDEMNITY COMPANY,the corporation described in and which executed the above instrument;that he knows the seal of said corporation;that the seal affixed to said instrument is such corporate seal;that it was so affixed by authority of his office under the by-laws of said corporation,and that he signed his name thereto by like authority. 7~~~ \Notary Public My commission expires April'1,1969 CERTIFICATiON? I,Wm A.Shrake,Assistant Secretary (Fidelity and Surety)of THE TRAVELERS INDEMNITY COMPANY,certify that the foregoing power of attorney,the above quoted Section 12.of Article IV of the By-laws and the Resolution of the Board of Directors of November 30,1959 have not been abridged or re- voked and are now in full force and effect.~.)~.<O...,/f/}(.,f Signed and Sealed at Hartford.Connecticut,this ,A-<.?../II~day of ///Cl7 19 . S~496 (BACK) Assistant Secretary,Fidelity and Surety THE TRAVELERS INDEMNITY COMPANY BY:.()d~L!J-d7vA Betty Lou hook Attorney-in-Fact The Travelers Indemnity Company Hartford,Connecticut ,;-- SPECIAL POWER OF ATTORNEY KNOW ALL MEN BY THESE PRESENTS: (' That THE TRAVELERS INDEMNITY COMPANY,a corporation of the State of Connecticut, does hereby make,constitute and appoint Betty Lou Shook its true and lawful Attorney-in-Fact,with full power and authority,for and on behalf of the Company as surety,to execute and deliver and affix the seal of the Company thereto,if a seal is required,the particular bond,undertaking,recognizance,consent of surety or other written obligation in the nature thereof specifically described as follows: {,, iJ.J.1 Bond in an amount not to exceed FIFTY THOUSAND AND NO/IOO-~--------------------------($50,000.00)---------------- and to bind THE TRAVELERS INDEMNITY COMPANY thereby,and all the acts of said Attorney-in- Fact,pursuant to these presents,ate hereby ratified and confirmed. IN WITNESS WHEREOF,THE TRAVELERS INDEMNITY COMPANY has caused these presents to be signed by its Attorney-in-Fact and its corporate seal to be hereunto amxed this 19th day of December 19 67 ~~:E T~LERS INDE~NI~:OMPANY --~!:~--Austin F .Scha111\ttorn~~i-~~Fact &Pa., Resident Agent State of Pennsylvania,County of Allegheny -55: .On this 19th day of December in the year 1967 before me personally came Austin F.Schall to me known,who,being by me duly sworn,did depose and say:that he resides in the State of Pennsylvania ;that he is an Attorney-in-Fact of THE TRAVELERS INDEMNITY COMPANY,the corporation described in and which executed the above instrument;that'he knows the seal of said corporation;that the seal affixed to said'instrument is such corporate seal;that it was so affixed by the authority granted to him by the Power of Attorney which'appears upon the reverse side hereof,which iS,now in 11 rce and dZ2::2ICdthathaSigne, his name ther17to ~y like authority.",'. f..~:'I .'/'_ • ,,~.:!:-::.-:7 ············;·····NO··;y·-p~bii~········----···(~._.. SHIRLEY ANtrBlrsS,~Notary Pubuf-,.'.-'--~ Pittsburgh,AUegbenr County,PI,, My Commlssioa Explrea My commission expires 10/16/710Ct!Iber,16,1971 r 1~.~.,.~~~ ~c,~~~,J't" 5.496 REV.7-65 PR,NTED',N U.S,A.(Over) I" IN THE COURT OF COMMON PLEAS OF,WASHINGTON COUNTY,PENNA. (ORPHANS'COURT DIVISION) IN RE: ESTATE OF ELIZABETH S.KNOX a/k/a ) :NO.63-68-663 MRS.THOS.E.KNOX a/k/a) MRS.THOMAS E.KNOX, deceased PETITION TO FIX BOND TO THE HONORABLE JUDGE OF SAID COURT: The petition of Theodore M.Stine,respectfully represents: 1.That Elizabeth S.Knox died April 25,1968,a resident of Buffalo Township,Washington County,Pennsylvania, intestate,and your petitioner was appointed Administrator of her estate by the Register of Wills of Washington County on May 6, 1968. 2.That the decedent at the time of her death was the owner of the following described real estate situate in Buffalo Township,Washington County,Pennsylvania: BEGINNING at a point common to lands of Lawrence Kelly,Howard Ely and the tract herein conveyed~thence by land of Lawrence Kelly,North 68°17'West 976.5 feet to a point~thence by same,North 46°05'West 2152.1 feet to a point~ thence by same,South 18°18'West 87.8 feet to a point in line of land now or formerly of Mrs.Geolge Coogle;thence by land now or formerly of Mrs. George Coogle,North 62°22'West 1219.7 feet to a point;thence by same,North 47°24'West 854.1 feet to a point in line of land now or formerly of Leman Crothers Estate,North 42°55'East 922 feet to a point;thence by same,North 56°42'East 497.7 feet to line of land now or formerly of George Coffey;thence by land now or formerly of George Coffey,North 66°09'East 466.3 feet to a point; thence by same,South 89°44'East 566.3 feet to a point;thence by same,South 00°35'East 298.5 feet to a point;thence by same,South 81°11'East 1359.2 feet to a point;thence South 17°45'West 557.7 feet to a locust;thence South 14°35'East 1008.15 feet to a point;thence South 32° 45'East 1108.8 feet to a point in the National Road (U.S.Route 40);thence along said National Road,South 46°45'West 455.40 feet to a point;thence crossing said road along land now or formerly of James Woodruff South 39°54'East 27.24 feet to a point;thence continuing along land now or formerly of James Woodruff,South 47°40' East 380~91 feet to an iron pin;thence by same,South 73°20'East 284.6 feet to a corner post;thence by same,South 73°20' East 284.6 feet to a corner post;thence by land of Howard Ely,South 13°57'West 464.1 feet to the place of beginning. CONTAINING 177.297 Acres,more or less. SUBJECT to the exceptions,reservations restrictions and conditions appearing in prior deeds in the chain of title. BEING the same as conveyed to Thomas E. Knox and Elizabeth S.Knox,his wife;by deed dated and recorded in the Recorder's Office for said County in Deed Book 853 page 184.The said Thomas E.Knox died March 7,1968,thereby vesting the entire title to said tract of land in the decedent as surviving tenant by the entireties. 3.That your petitioner as administrator of the estate of the above captioned decedent's estate and as Executor of the Estate of Thomas E.Knox,the deceased husband of Elizabeth S.Knox,has entered into an agreement to sell all the real estate owned by the said Thomas E.Knox,deceased ,(except for a small par~el of 2 Acres,more or less,being conveyed to Fred Westfall et ux.) and the above named decedent for One hundred seventeen thousand and no/IOO ($117,000.00)dollars,the consideration allocated to the real estate described in Paragraph 2 above being Forty thousan~ and no/IOO ($40,000.00)dollars. 4.That there is attached to this petition the affidavits of two responsible persons acquainted with real estate values in the vicinity of said real estate setting forth the fair market value of the property proposed to be sold. 5.That your petitioner has been unable to file an inventory of the personal property in decedent's estate at this time as the value thereof will be affected by the balance awarded to her under the estate of her deceased husband,Thomas E.Knox~ however,your petitioner e.stimates said personal property to inventory at approximately $100,000.00. 6.That your petitioner filed bond in the amount of $50,000~00 with Travelers Indemnity Company as surety at the Register of Wills Office of Washington County at the time Letters of Administration were granted. WHEREFORE,peti~ioner prays Your Honorable Court to fix the amount of additional bond to be filed by your petitioner before closing out said transaction. COMMONWEALTH OF PENNSYLVANIA SS: COUNTY OF WASHINGTON Personally appeared before me,the undersigned authority,THEODORE M.STINE,who being duly sworn according to law,deposes and says that the facts set forth inthe annexed petition are true and correct to the best of his information, knowledge and belief. Sworn to and subscribed before me this .!.d.J day of August,1969. ~aM_~y~I\~2. MA§::,N,tarl Pdti, WASHiNGTON.W;'SH"N,,·TON co..f"A. My Commission Expires February 27,1971 IN THE COURT OF COMMON PLEAS OF WASHINGTON COUNTY,PENNA. (ORPHANS'COURT DIVISION) IN RE: ESTATE OF ELIZABETH S.KNOX a/k/a MRS.THOS.E.KNOX a/k/a MRS.THOMAS E.KNOX, deceased ·· : ·· NO.63-68-663 AFFIDAVIT OF VALUE COMMONWEALTH OF PENNSYLVANIA SS: COUNTY OF WASHINGTON Personafly appeared before me,the undersigned authori ty,__-..:....--,--_._.~G:..:.·._·..:.;H:..:e:..:.r-=s-=c:..:;h:..:e~l-=F:...·e=-t:.:h:..:e:..:r-=l.:..:i n::..·_.,and Lorela W•.Carl . to law,depose and~so:Y that they have inspected the real estate proposed to be sold by the Administrator of the estate of Elizabeth S.Knox a/k/a Mrs.Thos.E.Knox a/k/a Mrs.Thomas E. Knox,deceased,and that they are .acquainted with the value of the real estate in the locality of such real estate~that they are not employees of the fiduciary nor personally interested in the proposed sale~that in their opinion,the fair market value for the tract of land owned by decedent containing'177.297 Acres situate in Buffalo Township,Washington County,Pennsylvani , is Forty thousand and no/IOO ($40,000.00)dollars. Sworfi to and subscribed before me this~,,!d day of June,1969. \. .Notary Public EVELYN A.McDAID WA~i'lINGTON,WASHINGTON CO.,PA MY COMMJSSION fXP~ JUlY :29.1972 ." j IN THE COURT OF COMMON PLEAS OF WASHINGTON COUNTY,PENNA. (ORPHANS'COURT DIVISION) IN RE: ESTATE OF ELIZABETH S.KNOX a/k/a }... MRS.THOS.E.KNOX a/k/a } NO.63-68-663 MRS.THOMAS E.KNOX, deceased r969, of OR D E.!te AND NOW THIS .//day of upon consideration of the within Sherman H.Siegel,Attorney for petitioner,it is Ordered that Theodore M.Stine,Administrator of the Estate of Elizabeth S. Knox a/k/a Mrs.Thos.E.Knox a/k/a Mrs.Thomas E.Knox,deceased file with the Register of Wills additional bond with surety in ,~ amount of$.f:~.~,.-=before making sale of the real estate described in the annexed petition. j il(uDm .All mrn iy wlJest 'resents ELIZABETH s.KNOX a/k/a MRS. Estate of...:r.f.lQS.........E.......KNQX.....a/k/..a....MRS..............}N 63 -68 - 66~f 'Vv.vvvXXTHOMASEKNOX0-e ,,~~~/.}~ late of E.u.f.f.a..LO T.ow.nship ,Deceased KNOW ALL MEN BY THESE PRESENTS, That we,:E?~9..9..9.E.~~..~§.!:!.~.~~~.9.~E.?.:Y..~.~.~E~~.~.9~.~.~!.t.Y.~2.~p.~ny... all of Washington County,Pennsylvania,are held and firmly bound unto the Commonwealth of Pennsyl- . f h f h'd'h . h f Forty thous and D 11vama,or t e use 0 t ose Illtereste III t e estate,III t e sum 0 0 ars,to be paid to the said Commonwealth,to which payment,well and truly to be made,we do bind ourselves, jointly and severally,for and in the whole,our heirs,executors,administrators,successors and assigns,and each and every of them,firmly by these presents.Sealed with our seals and dated the ~.?~.0:day of ........Aug"JJ.s:t A.D.,one thousand nine hundred and ~J.~.ty.:::P.-JD.~L!.~..§.~.L. THE CONDITION OF THIS OBLIGATION IS,That if the above bounden TheodoI:e . M.Stine Administrator or any of them,shall well and truly a~lminist~r :~.,..,~'~"'; the estate according to law,this obligation shall be void as to th e who shall so adIl)jnister;inec'estate;but "...._.~...... otherwise .shall remain in for ~......: -IR(~:"~f'av'e ..·s....·l:'~..!·....m·nIt........Cc;in·p..·ah~AL) B l~.'',,'..·~..........·AEtorne'y'~:C ~c'f";J"':~'::(~EA~) .....................................................................................1....(SF,AL') ..........................................................................................(SEAL) it~trmrnt nf iurrty I,,,surety in the sum of $on the administration bond in the estate of ,say that I reside at ..............................................................................,Wasp.ington County,Pennsylvania;that I am the owner of real estate, the title to which is in my own name and .duly recorded,situated in~; , Washington County,Pennsylvania,worth above all encumbrances $;and that I am worth the amount expressed in said bond,ove~and above my just debts and liabilities. Street P.O. @ltatrmrnt nf §urtty I,~;;,surety in the sum of $on the,. administration bond in the estate of..,say that I reside at ..............................................................................,Washington County,Pennsylvania;that I am the owner of real estate, the title to which is in my own name and duly recorded,situated in,, Washington County,Pennsylvania,.worth above all encumbrances:$;and that I am:worth the amount expressed in said bond,over and above my just debts and liabilities. Street P.O. COMMONWEALTH OF PENNSYLVANIA,}SS. WASHINGTON COUNTY,. And now 19 comes .. who being duly sworn,says that he is acquainted with the financial standing of the securities to the within bond;that the said obligors have each executed the said bond and that the sureties thereto are the owners of real estate in their own right of value more than the penal sum of said bond over and above all incum- brances and exemptions. S'worn and subscribed before me this . day of A.D.19 .. /,.... '·/'....·r~ ~J ./,( V. -.4 ~ _1 7 ~, 5-'".., .-~:~.. ,,~"\...,' 1:\. :' ..,......~'\ (',.' I",.'''''h J .I, '. J ","*1 .--f No.63..,...68"",663 j\~miniBtrutiDn iBnnll ~.'-.- IN THE ESTATE OF ELIZABETH S.KNOX a/k/a MRS.THOS.E.KNOX a/k/a MRS.THOMAS E.KNOX,deceased u.J.- 0;"t"1 ~:;::p SoD .Andno~~ust~3::::,19 69 '::X:;~U1 -.within Boi]:ct a:PPr'~i1ed an~"--i,.,.,_Itt . ordered ~..._i93ed.U,.)~,o r-.. .-'-;.0 Russell'rino s~:~Cl~k 'O.C~Div.n. 9~C: •F 2 U"I Register Bond Book ~::b.Pag.e ,<.2.'- // SHERMAN H.~~L,E~IRE 215 Washington Tr~B~dg. y1vania 1 .. ~-~ ·The Travelers Indemnity Company Hartford,Connecticut POWER OF ATTORNEY KNOW ALL MEN BY THESE PRESENTS: That THE TRAVELERS INDEMNITY COMPANY,a corporation of the State of Connecticut. does hereby make,constitute and appoint -----Sam Noyes,Betty Lou Shook,both of Washington,Pennsylvania,EACH ---- its true and lawful Attorney(s)-in-Fact,with full power and authority,for and on behalf of the Company as surety,to execute and deliver and affix the seal of the Company thereto,if a seal is required,bonds, undertakings,recognizances,consents of surety or other written obligations in the nature thereof,as follows: --------Any and all bonds,undertakings,recognizances,consents of surety or other written obligations in the nature thereof not exceeding in amount One Hundred Thousand Dollars ($100,000)in any single instance _ and to bind THE TRAVELERS INDEMNITY COMPANY thereby,and all of the acts of said Attorney(s)- in-Fact,pursuant to these presents,are hereby ratified and confirmed. This appointment is made under and by authority of the following by-laws 6f the Company which by-laws are now in full force and effect: ARTICLE IV,SECTION 11.The Chairman of the Board,the President,the Chairman of the Finance Committee, the Chairman of the Insurance Executive Committee,any Vice President,any Second Vice President,any Secretary or any Department Secretary may appoint attorneys-in-fact or agents with power and authority, as defined or limited in their respective powers of attorney,for and on behalf of the Company to execute and deliver,and affix the seal of the Company thereto,bonds,undertakings,recognizances,consents of surety or other written obligations in the nature thereof and any of said officers may remove any such attorney-in-fact or agent and revoke the power and authority given to him. ARTICLE IV,SECTION 13.Any bond,undertaking,recognizance,consent of surety or written obligation in the nature thereof shall be valid and binding upon the Company when signed by the Chairman of the Board,the President,the Chairman of the Finance Committee,the Chairman of the Insurance Executive Committee,any Vice President or any Second Vice President and duly attested and sealed,if a seal is required,by any Secretary or any Department Secretary or any Assistant Secretary or when signed by the Chairman of the Board,the President,the Chairman of the Finance Committee,the Chairman of the Insurance Executive Committee,any Vice President or any Second Vice President and countersigned and sealed,if a seal is required,by a duly authorized attorney-in-fact or agent;and anysuch bond,undertaking,recognizance,consent of surety or written obligation in the nature thereof shalI be valid and binding upon the Company when duly executed and sealed, if a seal is required,by one or more attorneys-in-fact or agents pursuant to and within the limits of the authority granted by his or their power or powers of attorney. This power of attorney is signed and sealed by facsimile under and by the authority of the following Resolu- tion adopted by the Directors of THE TRAVELERS INDEMNITY COMPANY at a meeting duly called and held on the 30th day of November,1959: VOTED:That the signature of any officer authorized by the By-Laws and the Company seal may be affixed by facsimile to any power of attorneyor special power of attorney or certification of either given for the execution of any bond,undertaking,recognizance or other written obligation in the nature thereof;such signature and seal, when so used being hereby adopted by the Company as the original signature of such officer and the original seal of the Company,to be valid and binding upon the Company with the same force and effect as though manualIy affixed. IN WITNESS WHEREOF,THE TRAVELERS INDEMNITY COMPANY has presents to be signed by its proper officer and its corporate seal to be hereunto affixed this day of May 1968 . caused these 9th THE TRAVELERS INDEMNITY COMPANY By ¢d)/1aJ~,mt"'Y'Fidelity and SHeety State of Connecticut,County of Hartford-s5: On this 9th day of May in the year 1968 before me personally carne G.Roger \iVheeler to me known,who,being by me duly sworni did depose and say:that he resides in the State of Connecticut;that he is Secretary (Fidelity and Surety)of THE TRAVELERS INDEMNITY COMPA?\Y,the corporation described in and which executed the above instrument;that he knows the seal of said corporation;that the seal affixed to said instrument is such corporate seal;that it was so affixed by authority of his office under the by-laws of said corporation,and that he signed his name thereto by like authority. 5-1869 PR'NTED 'N U.S.A.268 Notary Public My commission expires April 1,1969 (Over) CIRTIFICA.TION I,E.A.Houser III,Assistant Secretary (Fidelity and Surety)of THE TRAVELERS INDEMNITY COMPANY certify that the foregoing power of attorney,the above quoted Sections 11.and 13.of Article IV of the By-Laws and the Resolution of the Board of Directors of November 30,1959 have not been abridged or revoked and are now in full force and effect. Signed and Sealed at Hartford,Connecticut,this 12th day of August 1969 . 1-1869 (BACK) '" ~~fc~ Assistant Secretary,Fidelity and Surety #,. #•• f _'.-oj ...- ."~tatf uf 'fnnDYl.nanta,t lUi: C!tuunty uf Manl1tngtun \ Personally before me,the undersigned authority,a ~9..t..~;J;:y.r.~p.l:!s:in and for said County and State,appeared !..~.~.9..~9.E.~.:..~.~~..~~.~.~~who,being duly sworn according to law,deposes and says that he is the ~00:H:lXM"administrator of the estate of ~.!.t~.9J;?~.t.h ..;.?..~.....~~.9.~.....9:l~l~....~.;:.~.;~...::~.t!-.9.~..~;;.....deceased,that the foregoing schedules constitute aE.Knox and Mrs.Th.omas E•.Knox . .complete ll1ventory and appraIsement of the real and personal estate of...E.l.1.z.ab.e.t.h S Kn.Q~, deceased,except real estate outside the Commonwealth ofPennsylvania;that the figures opposite each item of real and personal estate in the foregoing schedules are determined and stated by the undersigned to be the fair value of said items as of the date of the decedent's death,based upon a just appraisement of each ~item made by the above named K~~K Administrator. da "s=.~~~~;~;:~.~a.~~;:.§;:.th;.~~.3._·),.._~.:;t~;, .........................~~..~) ADDITIONAL INSTRUCTIONS 1.An inventory ust be filed within three months after appointment of personal representative..r; 2.A supplemental inventory must be filed within thirty days of discovery of additional assets. 3.1 Original and 2 Copies and 2 RCRI-34,Under $10,000;1 Original and 2 Copies and 2 RCRI-33, Over $10,000,including Copy of Will;1 Original and 3 Copies and 2 RCRI-33,Over $50,000,in- cluding Copy of Will and copy of Federal Estate Tax Return. .REFERENCE FOR ADDITIONAL COpy Act of 1947 P.L.513 Sec.5.2,72 P.S.4844.2 .to 3~~J?-~~-3 ,.i\ffiItuuit (@f tExreutnr (@r A~miui!itrutnr j .~.. ~,, lInutntnrganb !\pprablt~tnt of the goods and chattels,rights and credits'!P.~ich were of ~..~.~.~.~.~?.~.~~~.~~~.9.~late Of ~.~.~~.~.~.?~.9.~~~!2~.p..r... Washington County,Pa.,taken and made in conformity with the abave affidavit. .. PERSONALTY: Mellon National Bank &Trust Co ...(Claysville Branch) checking account Mellon National Bank &Trust Co.(Washington Branch) savings account DOLLARS 2087 12769 CENTS 93 80 Mellon National Bank &Trust Co.-Savi!1gs certificate #02381 Mellon National.Bank &Trust .Co •-Savings Certiftcate .#2158 Mellon National Bank &Trust .Co.-Savings.Cer'tificate#2157 '. 1000 00 5000 00 10000 00 Mellon National Bank &Trust Co.-Savings Certificate #14284 ;States United/Savings Bonds -Series H: .5000 00 Proceeds auction sale -cattle and farm equipment John M.Stanley -account due Internal Revenue Service -refund 10 -$1000 face amount 4 -$5000 face amount Household furniture 1955 Packard Sedan .. t· $10,000.00 20,000.00 30000 00 .\ 20 00 100 00 1583 00 1621 75 200 00 Interest in estate.of deceased (husband,Thomas..E.I<n'ox~:~ Legacy 1/2 residue (estate) (Continued on back) $10,000.00 20,000 •.00 Total 30000 ·99382 00 48 REALTY: Home Farm -Route 40,Buff.a10 Township,Washington County,Pa. containing 170 Acres consisting of...~No.unts.tract and NohLe..tract. Improvements consist of 2...story ..frame dwelling,2 story brick dwelling,2 frame barns,garages and other outbuildings. For legal description,see deed to William A.Schandated September 16,1969,in Deed Book page House and .1ot-Village of Taylorstown,Blaine Township', Washington County,Pennsylvania.See deed of Beu1ah.ScQ_tt - Deed Book 998 page 196 ..~.~-'~f!"l':."tl'~ •,,~~,r:.?:\~~'I', House and lot -Village of Taylorstown,B1aine.T6Wnsp.ip, Washington County,Pennsylvania.See deed qf'Haz.e..L,.-Ly:le ......Deed... Book 979 page 221. Undivided 1/2 interest in and to oil and gas in and underlying Hodgens Farm.in 'Blaine Township,Washington County,Pennsylvania, containing 251 Acres.See Deed Book.650 page 20. Total Grand total $40,000.00 5,000.00 3,000.00 5,000.00 $53,000~00 $152,382.48 00°..::r::><:80z.~:.I "'~~('II','I~~.i ~i .",i ~\~\'\\. ~. ~ril !1 '""1'I':""...".''''.i~~~~~ .....!ol '.I't "llL~ ~ct:loo!'.~,P:It"~~'-~i .:·i':',t·S " ~<uo.l<:::~'"'-0': "'0.~~,;, \-- \.~~ct:l::r:i i .-69 OCT 23-.~t N :><:8!! H'O ct:l "':::>- -I:l..~• • ',' ~.P..--l·r-! Q ~N O '1 1 \PH]16. OUQ s:: ...j zoo:: 00 ct:l ]~~~<1 ('('):ril ~:> \<:3 ~:H: ''WSS .i,~f~ kl "Q):fUE ..ttL A1~~::J:::oo'O!.olchs:::: QbStfR~U~UiO E-l s:: .....::r:ct:l'0 :~~8:.jJl ~ASmN;;roOFWItts s::s:: ;:>~ril:><:!d °i 0.Q) ~t:Q °,Q).0, J .N C oo.jJ Pol .....F:t:zi~! .0,.PI< O'i .. e-::I ~lQ)1 .., •s::s:: H:O : ::r:.r-!0 H •lQ)'"I::l Z .c:.jJ ril ril P ~ ~~.g' :~ I ~'r-!.c:ril Lf')til::r:..--l ct:l 00 N .~ _______J r r "f IN THE COURT Of COMMON PL~AS OF WASHlNGTON COUNTY,PENNA. NO.63-68-663 IN RE: ELIZA.BETH S.KNOX a/k/a MRS.THOS.E.KNOX a/k/a MRS.THOMAS E.KNOX, deceased PETITION TO FIX BOND COrder Within'- r···",......'••?' o ~ ... c::rlc..o ::::::.c::c:-> ::r;::.. :3: c::3 U"J r0 \0 ~::;-, .);>I"Tl :;Q (f)qC::::r:-(f)~=:(f)en ,'1 ~~.~-~1"~:TT.I ~.:~~,.-",0~~;;::~:Q >2'.-.,:;~~~~~iIJ-#.......~ ..........~ ~j -SHER.MAN H.SIEGEL :). .," " .., ~l .•r r~~,t !1-~ ATTORNEY AT LAW WASHINGTON.PENNSYLVANIA WASHINGTON TRUST BUILDING Id-J -1:15' 1 FIRST AND rINAL ACCOUNT of TheodoreM.Stiner Administrator of the Estate of ELIZABETH S. KNQX,late resident of Buffalo Township,Washington County, Pennsylvania. THE ACCOUNTANT CHARGES HIMSELF AS FOLLOWS: Inventory and Appraisement: PERSONALTY.'$99 r 382.48 REALTY ,$152(382.48 To gain in conversion of assets and adjustments to reflect Federal Estate Tax Valuations as per Schedule A 15,053.97 'To income received as per ScheduleB 10,643.92 William A.Schan -received on adjustment of taxes and rents on sale of real estate '63.56 TOTAL DEBITS $178,143.93 TOTAL CREDITS '57,541.70 BALANCE '$120,602.23 THE ACCOUNTANT CLAIMS CREDITS AS FOLLOWS: 1968 May 11 Lillian Harshman Leroy Kelley Custodian of house during administration Labor for care of cattle,preparing for auction sale,etc. 525.00 983.19 Nursing decedent18JadwicaVezie Elizabeth Hart Althea H.Phillips Mrs.LQuiseA.Burns';';",.'.~.;.'--. ~. ." .Curtis pharmacy GeorgeE.Mumper Agency " " Account due Insurance Less refund " " " 284·.00 t5.00 105.00 75.00 168.75 112.50 5.65 269.00 Account dueMcVehilPlumbingCo. Bell Telephone Co. West Penn I?owei Co. " " " 36.03 30.87 90.86 ·,. 1968 May 11 Columbia Gas of Penna. 25 Brownlee Funeral Home Account due Burial expense 76.40 2701.50 Paul C.Snoke,V.M.D.Veterinarian fot cattle 5.00 Arrow Ins.Agency,Inc.Admnr.Bond.premium 260.00 28 Gail R.Miller June 1 Walter Grose Market , Labor for moving house- hold furniture' Account due 31.75 3.20 11 Pa.Dept.of Revenue Car title transfer 27 Mary S.Croth.ers,ColI.1968 Road taxes Charlotte Wallace,ColI.1968 Road Tax 1.00 33.38 22.23 ' July 13 Donald Hodgens Appraisal fee-household furniture 40.00 27 Malcolm Morgan,Co.Treas.1968 County tax 118.34 Aug.30 McWreath Dairy Sept 13 'Richard Kelly 18 Michael Pattison Account due Moving expense Labor 3.00 20.00 12.00 24 Charlotte Wallace,Tax ColI.1968 School tax Mary S.Crothers~ColI.1968 School tax 157.39 262.22 ,20 Nickles Bakery Oct.17 McKean Plbg.Co. Howard Mounts Account due Plumbing repairs Route 40 house Electric repair Route 40 house 3.50 7.88 6.00 12 James R.Pitcairn,Inc.Repairs-Rt.40 house 16 Hapchuck Sanitary Service Cleaning septic tank Route '40 house 28 William Scott Repair barn-Rt.40 farm tIapchuck Sanitary Servo ,Repair septic tank Route 40 house 37.46 40.00 10.00 250.00 Nov.8 George E.Mumper Agency Liab.Ins.-Taylorstown 15 Julian I.Fine Dec.6 Coen Oil Co. 1969 Feb.20 Simon White's Sons Mar.6 Gaylord Miller Appraisal-real estate Sink-Taylorstown house Marker Hauling water for Taylorstown house 17.00 250.00 114.48 160.00 8.00 -1969 Mar.28 Gale R•.Miller Apr.14 Tnt.Revenue Service 29 GeO.E.Mumper Agency Slag-Taylorstown house 14.83 1968 Income ~ax 126.26 Fire ins.premo 156~00 Refund -1'09.00 47 .00 May 9 Observer Pub.Co.Advt.grantletters 12.50 Arrow Ins.Agency Admnr.bond premium 260.00 17 Hapchuck Sanitary Servo Clean septic tank- Rt.40 hOuse 45.00 June 21 Mellon Bank Safe depos.it box rent 4.00 Int.Revenue Service Addl.income tax~1968 9.56 Charlotte Wallace,ColI.1969 Road tax 22.23 Mary S.Crothers,ColI.1969 Road tax 33.38 Malcolm L.Morgan,Co.Treas.1969 County tax 133.12 Gale R.Miller Paint....·Taylorstown hOuse 12.61 CharlotteA.Wallace ,ColI.1969 School tax July 9 McKean Plbg.Co. Aug.6 Mary S.Crothers,ColI. Sept.2Q Int.REvenue Service Plbg.repair-Rt.40 " 1969 School tax Federal Estate Tax 115.60 262.22 157.39 6996.16 22 Transfer taxes on sale of real estate to WilliamSchan 800.00 23 Sunny Hills Realty William Scott Broker's commission Plbg.repair....Rt.40 House 2400.00 20.00 Oct.17 Coen Oil Co. GeO.Mumper Agency Nov.3 Int.Revenue Service 6 Mellon Bank 22 Arrow Ins.Agency 1970 Apr.14 Int.Revenue Service 15 Sherman H.Siegel 16 Int.Revenue Service Space heater 380.54 Public liab.insurance 17.00 1969 Income Tax 69.96 Bond handling fee 3.00 Addl.bond premium on sale of real estate 160.00 1969 Income Tax 341.39 alc counsel fees 3000.00 Deficiency assessment Federal Estate Tax 3542.25 May 15 Mellon Bank Lock Box rental 4.00 1 I ,'C..~" I I I 1970-- June Sherman H.Sie,gel Reimburs ement for: T9:68 - May'6 Reg.of Wills Probate costs 26.0016Wash.Co.Reps.Advt.letters 12 ..50JUly1Reg.of Wills,Sht.certificate 1.00Oct.28 """""1.00 1969 Aug.ll """Petition sale of real estate 10.00Sap.23 """Sht.certificate 1.00Oct.23 """:riling inventory 8.:00 59.50 Arrow Ins.Agency Administrator bond- renewal premium 260.00 I Russell Marino,Agent Pa.Estate tax 266.42 Margaret Bails Notary fees 10.00 Sherman H.Siegel Bal.counsel fees 4875.00 Theodore M.Stine Administrator's fees 8907.20 Russell Marino,Reg.Filing this Account 20.00 TOTAL CREDITS 40441.70 1968--July 25 Russell Marino,Agent: a/c Inheritance tax $18,000.00ILess5%discount ":900.00 "17100.00I I TOTAL CREDITS 57541.70 'ELI'ZABE'TH S:.'KNOX ESTATE 4,.".. Schedule showing gain on conversion of assets and adjustments to reflect Federal Estate Tax Valuations' :E,>ERSONALTY: Residuary interest in estate of deceased husband,ThomasE. Knox: Appraised at Awarded at Household furniture: Appraised at: Sold for REALTY: ,$20,000.00 ' 30:,938 .97 1,583.00 ,1',598<.0,0 $10,938.97 15.00 House and lot-Taylorstown (See deed of Beulah Scott): Deed Book 998 page 196 appraised at Federal Estate tax valuation House and lot -Taylorstown (See deed of Hazel Lyle): $5,000.00 ,7,50:0.00,2,500.00 Federal Estate Tax valuation Deed Book 979 page 221 appraised at $3,000.00 ' '4,6'00.'00'"1 ,600 .00 - ,$15,053.97 SCHEDULE "A" ELIZABETH S.'KNOX ,ESTATE " ,'INCOME Rents: Lyle Miller Frye Woodruff ,niland Gas Royalties:, ,$810.00 ,855.00 50.00 ,T56'0.OO 426.49 $3275.00 Awarded from Estate of Thomas E. Knox 'T727.61 ,Inte'rest: Mellon National Bank &'Trust Co.- savings certificates 1328.75 2154.10 U.S.Bonds &Treasury Bills '3'886.07 5214.82 $10643.92 SCHEDULE"B" Observer .Reporter WASHINGTON,PENNSYLVANIA PROOF OF PUBLICATION In compliance with the News,paper Advertising Act of 16 May,1929, P.L.1784,as amended. Commonwealth of Pennsylvania,County of Washington,88:. Pe,rsonally appear,ed before me,a Notary Public in and for said County and State,Ri.c..b.!:\.r.Q ~.~J;~.Q.w..~n ,who beirug duly sworn according to law,deposes and says tha;t he is the ...s.e.c.r.e.tary . of the Obsrerver Publishing Company,a P!enrus~lvania corporation,and its agent in this behalf;that the s,aid Company is,the owner and publisher of the Observer-Reporter,succ'essor to The Washington Observer,established September 18,1871,and The Washington Reporter,established August 15, 1808,a daily neWSipape,r of general circulation,printed andpublisihed and haviIl'g its place of businesrs at Washington,Washington County.Pennsyl- vania,where it or its predecessors have been established and published continuousrly for more than six months:prior to the publication of the notice hereto attached;that the printed notice or advertisement hereto attached is a ,copy of an official advertisement,official notice,-legal notice or legal advertis,ement,exactly a:s printed or published in the Obslerver·Reporter in its regula;r editions on the following date or date,s;.. .....................................M.~.y 9..,J.(>~.ng ~.~..L.).9..9..~_ . that neither the affiant nor the Observer Publishing Company is interesrted in the subject matter of sraid notice or advertising and that all of the aUega- ~~~,~;.thl,amdavlt .,to='tl~~J:::;,";Ze=tl~n Sworn to and subscribed before me this._Z..~....day of....M~y...J.9..Q..~. .".,..7lI~~f.!;;'~;~~ WASHINGTON,WASHIfJGTON COUNTY MY COMMISSION EXPIRES MAY 6.1972 Washington County Reports ~Jtm:lr Washington,Pennsylvania (PUBLISHED BY WASHINGTON COUNTY BAR ASSOCIATION) Estate Notices The Register of Wills has granted letters, testamentary or of administration,in the following estates.Notice is herehy given to all persons indebted thereto to make payment without delay and to those hav- ing claims or demands to present t!hem for settlement to the Executors or Admin- istrators or their Attorneys. •• • • ••• • • ••• • • • • • PROOF OF PUBLICATION In compliance with the Newspaper Advertising Act of May 16,1929,P.L. 1784 Sec.3,paragraphs (3)and (25). COUNTY OF \VASHINr;TONt STATE OF PENNSYLVANIA (SS. KNOX.ELIZABETH S.,a/k/a MRS.THOS.E.KNOX,a/k/a MRS.THO-MAS E.KNOX,Dec'd. Late ofBuffalo Township,WashingtonCounty,Penna. Administrator:Theodore M StineTaylorstown,Pa." Attor!?-ey:Sherman II.Siegel,215WashmgtonTrustBldg.•WashingtonPa.·' Personally appeared before me,a Notary Public in and for said County and Commonwealth,CHARLES C.KELLER,who,being duly sworn,deposes and says:that he is the Editor of the WASHINGTON COUNTY REPORTS,the official legal periOdical for said Washington County,published weekly having its place of business at Washington,Washington County,Pennsylvania,and is act- ing as its agent in this behalf;that the said WASHINGTON COVNTY REPORTS was established on March 31,1920,and was designated as the official legal publication for Washington County,Pennsylvania,by order of the several courts oi said County,dated November 11,1920;that the printed notice or adver- tisement attached hereto is a copy of a notice or advertisement,exactly as printed or published,which appeared in the said legal periodical in its regular issues on the following dates: ......!~~y..J.9..,?~.,~.Q.l J9..Q.a ,. that the affiant or the corporation in behalf of which he is acting is not interested in the subject matter~.9fsitia-notice or advertising and"that all of the allegaticins"cf"'" this affidavit as to the time,place and charact.er of the .publicatioo afjjtrue. I (I J j'/I~f/a L/./-:~~(?~ ~'-"""""""'''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''Edi~~; Sworn to and subscribed before me this ~-----....--------.. ...~.9.!.~!!day of...~~Y.,196 8.. ....~.(!,- otary Public KATH~~INE C.YARD,tlolury Publi Wa""lngtoll,\~a~~.in..;ton Co.,Pall My Cumnlls211111 Expires I November 1,1969 STATE OF PENNSYLVANIA, WASHINGTON COUNTY,~55: The within named Accountant being duly sworn according to law,depose Sand say Sthat the above account as stated is true and correct as he verily believe. Sworn and subscribed before me this ....l.O.~. day of _._.._~~.~.¥..19 ?~. .~.~. MARGAR BAllS,Notary Public .. WASH1NGiON co..pA,\ MyC;~~i~ion 'Expires February 27,191t Washington County,55: ....~..~. I do certify that I have given legal notice to all persons concerned of the filing of the within account in the manner prescribed by Statute and Rule of Court,as evidence by proofs thereof filed to No..La3::::.7-0.-:.J.7.0 . Witness my hand and afficial seal t'nis.,3.j'~"""b day aL....~.........(Wj~.,.19..7. ..~~._.7!~. Register of Wills H'0 ~~-;- '0 +.J0>to til:....$-I:..., ~0 +.Jl l-o::l 0<Ui ....00,0J0:~•..-1:~0 0=aJi 0 ~i Q;l OJ ~..c::....'9 OJ •r-{;...,0 ~<Si t:"I L E p 0 .!d...,,'0:U;l-o .........'.9 ~F:r: 1 I Q;l a :0 ...>.~~...:'70 Jill 02 H Q;l \f;:,0>;10 Pt1 3 r:£I s::: ·et l-o0~i Cl 0 ~..., ~fil ~·,-Ii r:£I ...,...,<l1Eo<9 +.Ji s:::H<l1 ~tJ)! ::l tJ) Eo<=ti 0 ~RUSSEl.L MM~INO OJr:Jl OJ fil ~tI.j i!oj .,r4 d REGISTEH OF WILLS ..;s:::l-o ::c: p:::f 0>1 .~~I'l Q;l ~~~WASHINGTqN.qO ..PA....,.9 ...,Z ~rJJ ~$-I:.~...,'M .~0 ojH0:...,s Q;l ~~Q;l ~'~H '0:~..c::.=:..., 1~0:0 ....r:£I0>:s:::-8 t1 ::c:H ..en 't:l OJ :tJ)~0 tI.j 8 1 s:::z <l1 .-<...., ---- I;,• " _r __,__ ... •.'f"r._<c ....., '""~ " / - I11III .." " Qrnurt nf <lrnmmnu @rp4nun' ---------~----- In the mllitter of the Audit of Account in Estllite of ELI ZABETH S.KNOX,a/kla MRS.THOS.E.KNOX a/k/a MRS. THOMAS E.KNOX,deceased TO THE AUDITING JUDGE: Jl~nn.nf lUnn4iugtnu Qrnurt ilinininu No.1968-663 Qrnuuty / my AccountantEnter.appearance for _ 14th day of_----::S::..:e:::::..p=t..::::e~m~b::...:e:::..:r=___ N.B.-Counsel shall,by separaite paper,present a concise statement of each claim,w.ith supporting calculation of any interest claimed.Objections to an account as filed,shall be concisely stated in a separate paper. Council suggesting proper distribution shall file a separate concise state- ment in that regard. 1968-663No.._ In re Audit of Account in Esta;te of ELIZABETH S.KNOX a/k/a MRS. ~Hn~.F..KNAX ~/K/~M~~~HAMa~ E.KNOX,deceased AUDIT 'ra~rip~fnr !\pp~araur~ FOR Theodore M.Stine,~dministrator ~--.'""'-~;;0 -......z~.....".~.--(/)•'/.-v --.J_(0 c:_ 1"1...~~ ...I..--Cf)~r-- ::;;(,r,(fj '"'-i.~.::;-I.-~~ -0 ."co:::;;: r~ .!i-l--..r~.:"":r-o --.,.J :-. .";;-;0 ~;l~ •r--;- -0 i-;;z:'"!>-(..-')o· ''''-C" SHERMAN .R .SIEGEL,.ES0UT RF: Attorney ~2 .~': I (Form where decedent died intestate) Ju tqr (@rplJaus'atnurt of lIasQtugtnu <tInunty ELI ZABETH S ..KNOX No.1968-663 a/k/a MRS.THOS.E.KNOX or MRS.In the audit of the First and Final THOMAS E.KNOX,Account of Theodore M.Stine, Deceased Administrator State (I)whether de- cedent was married or unmarried;(2)if mar- ried,whether a husband or wife survived and his or her name;(3) whether or not there was any marriage settle- ment;(4)whether or not family relation was maintained until deced- ent's death;and (5) whether the decedent left children or issue of deceased children: The petition of.J.h.~9.g.9.~.~M..!?.t.;!,.P~_. (Name of Petitioner)_ respectfully represents:. (a)The decedent died ~P~JJ ~.?.l....J..~.9..S ,intestate and (Date) letters of administrationon 0:~E estate were granted M9.-Y 9...I .l..9...6.8... (Date) as per record thereof appearing in Administration and Bond Book No ~.~.. at page 24.8 . Decedent was survived by a brother,William P.Stine,and a nephew,Theodore M.Stine,her only heirs at law.Said decedent's spouse predeceased her March 7,1968. (b)At the time of death,the decedent's domicile was ~~~the Com- monwealth of Pennsylvania,to-wit,at.....!3.~.~.~.~J.9.~.9.~.!:l:.~.hJp .. (Town or Township,State and Nation) and residence was at...~.~.P..~~.:?..~~9.-.~h~.~~,r~.9.~..L ..~.~~.!:l:.~.~...l•....Y..!.§...!.~.~.. (Town or Township,State and Nation) (c)The names of all persons having any interest as heirs or next of kin with the names of their deceased parents,to show relationship if they take by representation are as follows: NAMES William P.Stine Relationship Brother Interest 1/2 Of age,sui- juris,or not, (write yes or no). esidue Name of Guardian,Trustee or Committee,if any,or beneficiary,manr~er and place of record of appointment and is bound suffi- cient to cover and protect share. sui juris Theodore M.Stine ~~~' Nephew 1/2 ~l ~.....i Julh,,'.1I~"~--~v , \ esidue sui juris State exceptions,if any, giving names and dates of death and the names of their executors or administrators,or the names of their issue as the same may be'mater- ial. Describe type of notice. All of said parties III interest are living,except No exceptions written (d)All parties having any interest have had notice of the filing of the account by regular mail dated August 25,1970,copy of sald Notlce belng attached hereto. (e)Balance for distribution per Account (f)Additional debits,not shown by Account (Itemize) See sheet attached. $..}..?9..!..?.9..?..•23 $?L~.~.9.13 (g)Additional credits,not shown by Account (Itemize) See sheet attached. $??.?...~50 $1.2.2..,..5.3.6...8 6 'r'~'..,.I \.0..t N'"tax. not (h)Claim for exemption has been/made,and has no.t been paid. (i)The estate is subject to the payment of inheritance tax to the Sta.te of ~~:p.~ylvani.a.($17,100.00 ($18,000.00 less $900.00 discount) pald 7/2~/bB and $266.42 paid June 16,1970. (j)The estate is not subject to the payment of the county 4 mills Insert word "not"where necessary. If taxable state wheth- er tax has been paid. 11 too many for the space,annex a list there- of;if no such claims, insert the word "none." If any creditor or other claimant has not re- ceived actual notice,that fact must be stated. Indicate such claims as may be secured or eow titled to a preference, and give detailed infor- mation concerning such security or preference. .'(k)The estate is ,..subjec,t to the.payment of Federal inheritance tax.Federal Estate Tax is paid,copy of closing letter attached. \(1)All creditors (and other persons who have complied with Rule II, Sec.9),of whose claims the accountant..??:.~notice or knowledge,have' ........................received actual notice of this audit;the amounts of their claims and whether or not they are admitted to be correct are as follows: NONE Here insert a reference to all questions requir- ing adjudication,and a statement of any mater- ial facts not already given.If none insert the word "none." If any share has been assigned or attached that fact should also be stated here. (m) NONE (n)The balance for distribution consists of pr,operty in kind,form and character,as follows: Real estate - 2 parcels of land in Taylorstown $12,100.00 State kind,form and character of property composing the balance for distribution,and if any part thereof is not cash,whether or not there has been any elec- tion to take such part in kind. 'Hodgens oi~and gas interest 5,000.00 Balance in cash . ......... ~ Are there any advance- ments by decedent to be considered on distribu- tion and has any distri- bution on account been made by accountant to any distributtee? (p) No advancements If prior accounts have heen filed,list number and term. (q)Give brief location of any real estate sold. Buffalo Township,Washington County,Penna.,177.297 Acres more or less,late residence of decedent on U.S.Rt.40 West. (See Petition to Fix Bond and Decree dated 8/11/69 at No.63-68- (r)No prior accounts filed.663) Wherefore your petitioner asks that distribution of principal and income be·awarded to the persons thereunto entitled and suggests that the balance of principal and income should be awarded respectively as follows (shares being stated in proportions but not in amounts):- (a)Balance of inheritance taxes,if any, (b)Payment of audit costs, (c)Balance in equal shares to:William P.Stine (1/2) and Theodore M.Stine (1/2),as sole intestate heirs. Legal descriptions of real estate are attached herewith. County of Washington,ss. The above named petitioner being duly sworn doth depose and say that the facts set forth in the foregoing petition are true to the best of h ~.~knowledge and belief; Sworn to and subscribed before me this ·9 th day of.....?.§P.t.§!nP..~.L ,19 ..7..0 . ~~.~...~.........•. -~MARGARET BAILS,Notary Public .....___~~I!..:I!!'!~.T.'?~!..W.~.!!HJ~aT.ON..cO""•.I>A••••••••••••••••••• .My Commission Expires February 27,1911 And your petitioner will,etc., -~~~---- (Sign·ature of Petitioner) I I C' I ; ~, '.~ '"~ FORM IN CASES OF INTESTACY No.._.,.___Term,195 ,A. A. IN THE ORPHANS'COURT WASHINGTON COUNTY,P A. Estate of ELIZABETH S.KNOX a/k/a MRS.THOS.E.KNOX and MRS.THOMAS E.KNOX,deceased K~~iKX!:X······························-···-···············~~dl:X . Sur account of ~.h~g9.9.~~~_~§.t::t.n.~.f.. Administrator PETITION SUR AUDIT In Conformity with Court Rule III, Sec.5 (B) COUNSEL FOR THE ACCOUNTANT WILL SUBMIT HEREWITH 1.The letters of administration. 2.A copy of the inventory and appraisement. 3.Proof of advertisement of the grant of letters, if not filed with accountant. 4.An appearance for those represented. 5.Inheritance tax receipts,if any. 6.Certificate of liens in case any of the funds fo,r distribution are derived from the sale of real estate. 7.Copy of Federal Estate tax return,if estate is subject thereto. 8.Signed elections to take in kind,if any. SHERMAN H.SIEGE.L,ESQUIRE.._-_._---_._------_._-___.._._-..__.--..-----------_------------- Attorney ~2 'Vd "00 NOltJNtHSV'M SII!!A .::10 tl3JSI~3U ON IIIVI'l TI3 SSntj h2 21 Wd L no OL4 ','-'~'~1,"'1'I,d -,t -~J...J .,~,.' IN RE: ESTATE OF NO.1968-663 ELIZABETH S.KNOX,deceased ). Ce)Balance for distribution per Account (f)Additional debits,not shown by Account: ". $120,602.23 1970 July 30 Oil and gas royalty 159.70 Aug.6 Interest-U.S.Series' H Bonds 223.50 6 Interest-U.S.Treasury Bills 511.80 Sept.4 Interest-U.S.Series H Bonds 130.90 Miller rent 45.00 14 Lyle rent 180.00 Interest on Treasury Bills maturing 10/8/70 975.90 Interest on Treasury Bills maturing 10/15/70 263.33 2,490.13 $123,092.36 (g)Additional credits,not shown by Account: 1970 July 10 28 Sept.14 McKean Plbg.Co.-repairs 74.37 Internal Revenue Service- interest on deficiency assessment on Federal Estate Tax 157.99 Charlotte Wallace,Tax Collector,1970 Road tax 22.23 Malcolm L.Morgan,Co. Treas.1970 County tax 49~91 T.M.Stine -balance Administrator's carom.125.00 Sherman H.Siegel-balance Attorney~s fees and Short Certificate 126.00 Balance for distribution .555.50 $122,536.86 .r-' ) .,,. In t1Jt monrt of <!rommnn JUtUS of lIus4iugmn QIounty. 'tnnsylnuniu.(0rp4uns'QIoun 13itrlswn .~. ESTATE OF Elizabeth S.Knox,a/k/a Mrs. Thos.E.Knox elk/a Mrs.Thomas No._'_.loC.6,.L;3-=6~8=-.......66....,3,)--_ In the matter of the,__F_i_r_s_t_a_n:i__F_i_Ila_l__ Account of Theodore M.Stine E,Knox,deceased Admini:strator ADJUDICATION AND ,DECREE And now October .Z ,19-'lQ.,this matter came on for hearing, audit and distribution at this session and testimony taken;and thereupon,upon due consideration thereof the bal~6e for distribution in the hands of the Accountant is determined to be $J22,Sea~and the account is accordingly confirmed;and it is ordered, adjudged and decreed that the said balance be paid out by the Accountant in accordance with the schedule of distribution hereto attached and made a part hereof,unless exceptions hereto be filed sec.reg.or an appeal be taken herefrom sec.leg. SCHEDULE OF DISTRIBUTION Balance per account _ Additional debit asked at audit Additional credit asked at audit Balance --,-_ Deduct Clerk's Costs &Receipts~~____ Attorney Sherman H.Siegel Russell Marino,Clerk O.C.,costs in cert~fying I real estate to Recorder, Recorder of Deeds for Washington County,costs recording certification of real estate, $120,60 2.23 2490.13 $123,092.36 555.50 $122,536.86 Russell Marino,Agent,transfer'inheritance tax,$1073.89 Interest from 7-25...69 to 10-17-70 ,79.,;I/~ William p.Stine,bro~her,1/2 balance,ihclu- ding an undivided 1/2 interest in decedents interest in real estate as hereinbelow des- cribed:an undivided 1/2 interest in Hodgens Oil and Gas interest valued at $2500.00 and cash;held in kind and distributed as such at the appraised value, Theodore M.Stine,nephew,child of George J. Stine,a debased brother,1/2 balance,inclu- ding an undivided 1~interest in decedents interest in real e state as hereinbelow des- cribed;an undivided 1/2 interest in Hodgens Oil,&Gas interest valued at $2500.00 and cash;held in kind and distributed as such at the appraised va~ue, 1153.02 $121,280.49(9J.2:l 1970•Pdl...//.s-~o;U 'I-'~~j~ 60640.e~ No balance ). r'.- .'~...'.......- .'1 ., \1 r ,. o..... ,, ~:;s.n r'l -+o ~:Tc:(\)a 3o0.....::l:(l) ""o.....go (l) ,. .. Z? " fL II'". t' 'j ,< r \ ,\ \ r " '('(, , I ". 'j REAL ESTATE TO BE CERTIFIED TO THE RECORDER OF WASHINGTO IT COUNTY BY THE CLERK OF THE ORPHANS'COURT D~VISION ,. ElizabethS.Knox a/k/a Mrs.Thos.E.Knox a/k/a Mr •Thomas E. Knox,graritor by intestacy to William p.Stine,grantee Py intestacy of !In undi,vided 1/2 interest;to Theodore M.Stilne,granlJee by inte- " stacy'of an undivided 1/2 ~nterest;each undivided inter~st being in ,- and to all the right,title and'interest of the deceased grantor in parcels of real estate descri'bed as',VIZ: 1.ALL that certain lot of groimd situate in T~ylorsto n,Bla.ine " Township,Washington County,',Pen!lsylv~nia,being known 81 d designa- ted as the Western one-half of Lot 'No.62 in the plan of Taylorstown, which plan is of record in Plan-Book 1 page 75,said lot being des- cribedas follows: FRONTING 30 feet on the South side of Main br Marke Street and extending back of uniform width,264 feet to lan~of The dore M. Stine,being bounded on the East by land of Theo~ore M.:tine and on ~ the West by land of Charles E.Crothers. BEING the same l?t of ground conveyed by de~d of Ha el Lyle, widow,to Thomas E.Knox and Elizabeth S.Knox,~is wife dated Novem- ber 13,1956 and,recorded in the Recorderts Offie e for W~shington County in Deed Book 979 page 221.The said Thom~s E.Kn<x died March, 7,1968,whereupon the entire"ti tIe to said premiLses ves lied in the said Elizabeth S.Knox as surviving tenant by th~entire ies. UNDER AND SUBJECT TO the excep tions,reservlitions,res triotions and conditions set forth or referred to in prior deeds il the chain of title. ..,,~ 2.ALL that certa~n tract of land situate in Baine Tmnship,Wash- ington County,Pennsylvania.,bounded and descri b ~d as fo.lows: SITUATE on the East side of the public road leading from Taylors- town to the B &0 Railroad Station in Blaine Tow~ship anc running .\'.' , t •f'"-f·' \. ,' ,. "I \' -,." ~," +.~t 1 1 ,...." .., r ,~., ,. . r ) ",, ',./ .,. ). . I ... " ,. , I ...' --~--------------------------------------- ,M-..-::.-....: along the middle of said road,North 20Q West 80 feet an extending back of equal width,North 70°40'Ea.st a dis tan e of 27 .25 feet to in the Being the (See the chain gas under- Penns.yl- d in Deed ies. ~. ..... .~, 3.ALL the undivided 1/2 interest in and to th all .j UNDER AND SUBJECT to the excep'~ions,reserv tions,estrictions the land now or formerly of Joseph M.McKee;sai lot co tains one- in.Deed Book 998 page 196.The said Thomas E• same as devised to decedent by her husband,Thom half acre of land and lies between the lot purc sed by •J.Stine on the North and the land now or of ti tle. arid',conditions mentioned or referred to in prior lying the Hodgens Farm in Blaine Township,Washi gton vania,containing 251 Acres as more particularly Book 650 page 20 in the Recorder's Office for s~ !: said Elizabeth S.Knox as survivingltenent by th South.-: .BEING the same tract of land Scott,t;-;., unmarried,to Thomas E.Knox and Elizabeth S.Knx,his ife,dated·./ July 12,1957 and recorded in the Recorder's Ofr ce for aid County 1968,whereupon the entire title~to said tract 0 Certification of Real Estate recorded in said He order's Office in Deed Book 1314 page 644). CERTIFIED TO RECORDER:OCTOB 23,19 o. Ill:" .'." ~.," 'f 1"','• ~. tN .) '-:<......,, ~ f"V ::)'::'..Cl... P r- L"'"oW !-- (0..) Cl c:::J tl.-r--.. r . ," ,-,) " .. I' " ~:J Z n :?!=> 0c (l) ~3' 0 0 -t.:l: ,.1.·.1 (l),t ,"f'0-t........':::r:.r ~(l) .....~:t ''1 ........ .."... .. 2 i .,.. IN THE COURT OF COMMON PLEAS OF WASHINGTON COUNTY,PENNA. (ORPHANS'COURT DIVISION) IN RE: ,~. ) ESTATE OF ELIZABETH S.KNOX a/k/a MRS. /THOS.E.KNOX a/k/a MRS.THOMAS E.KNOX, deceased NO.63-68-663 -PAY TRANSCRIPT Russell Marino,Clerk,costs and receipts Russell Marino,Clerk,costs certifiying real estate Recorder of Deeds,costs recording certification of real estate Russell Marino,Agent,transfer inheritance tax WilliamP.Stine,brother, 1/2 balance Theodore M.Stine,nephew, 1/2 balance ", 5. 1153. ., ., J.... ..... I I t ., ~ iIi, J .' • "4, IN THE COURT OF COMMON PLEAS OF WASHINGTON COUNTY,PENNA. NO.63-68-663 IN RE: ESTA.TE OF ELIZABETH S.KNOX a/k/a MRS.THOS.E.KNOX a/k/c MRS.THOMAS E.KNOX, deceased PAY TRANSCRIPT..·°1"1--.. c::-Cl e:::::-.-,,,"I ,OJ __c:::'1 --(/)0:..rn l-,---\."r"j ·...n::::c'"t"'~_t ~....,) c·.:.-t-r-"~..0 ~--....-4 ~r--"=-~0 _._.--"" -i._-no _"......-C·lt ~ ~.==~-I ~;:. -0 I 0'-J""(j')(..n SHERMAN H.SIEGEL ATTORNEY AT LAW' W'ASHINGTON,PENNSYLVANIA -- WASHINGTON TRUSTBUILDING ~~l .< Form RCC...33 n.ESIDENT DECEDENT COMMONWEALTH OF PENNSYLVANIA DEPARTMENT OF REVENUE BUREAU OF COUNTY COLLECTIONS COUNTY OF W~I?.Ip:.NG'I'.QN .. IMPORTANT:This return must be completed in detail and filed in duplicate,'with will attached,with the Register of Wills of the County where decedent resided;Return is due within one year after date of death,unless an extension is granted by the Secretary of Revenue.(Section 703 of __the Inheritllnce..an~.~E.E11;ateTe,x A,ctof lQ!ll.) ..Qil@(eiK and sayAdministrator IN THE MATTER OF mE ESTATE OF }~t.6i~:~J~M~S..~.~.~~.~~~~~~..~:i.~~~.~~~..:......;;~::XOF (State full name of decedent)fl.~NR ~te of .a.JJ..f.,f.gJ.O..'ro:wnship ,~ADMINISTRATOR state of ?~.r.:1.:I!.§.Y.:.L..YC3:.r.:1..:i.:.~,".} .•·$8: County of w:ash;l.ngtQn.~' ............................................!.-'.h.~QqQ.;t;:.§M S.t.in.e . of the estate of the above'1'!\med decedent being duly sworn,depose Decedent'died That as such ....Admini.s.tJ:a:tor depon~ntis familiar with the affairs of said estate and the property con- (I·;xecutor·Administrator) stitQting the assets thereof and tbeir fair market value. That at the time of death there was PO l3afe deposit box registered in decedent's individual name,or jointly with;or as agent or deputy of another,Qr in decedent's individual name,with right of access by another as agent or deputy,with the exception of the following:- ....-THIS SAFE DEPosiT aox RENTED RELATIONSHIP OF JOINT.NAME AND ADDRESS OF BANK OR OTHER INSTITVHQNINWHICHDECEDENTRENTEDASAFEDEPOSITB.QX IN NAME OR NAMES OF HOLDERS TO DECEDENT Mellon Nr:ltinnal Br:lnk &.·r.n Thomas E.Knox and 'T.":_':_.LIS Branch ,_.•._. Elizabeth s.J ....Claysville Knox.. Clavsville Penn!':vl '\7r:ln;rl (Thomas E~Knox died _•••->March 7.1968).- .. That the contents of said,~afe deposit box or boxes are itemized under Schedules of this return,with the exception of the foUowil1g,for the reasons hereinafter set forth: That Sc.hedule A attached h,ereto and made part hereof sets forth fullv and in'detail all the real'property in the Commonwea.l th of Pennsylvania of which decedent died having an interest therein.It 'also sets forth the mortgage encJ,1ll1bral1ces upon each parcel of real property at the date of death,giving the amount still due at death,name of mortgagee,date,rate of interest,and book and page of record thereof.It also sets forth in the co'lumns provided therefore the assessed valuation of each of said t.parcels,the estimated market value thereof as of date of death of decedent. That Schedule B attached heretQand made part hereof sets forth fully and in detail all personal p,roperty wheresover situated owned by the decedent at the time of death;all moneys left by the decedent at the time of death,whether in decedel1t's immediate possession,standing to decedent's credit in banks of deposit,savings banks,trust companies,or other institutions,whether indiVidually,or in trust for any other person or persons giving also separately the accrued interest thereon,if any,down to the last interest day prior to decedent's death in the·case of savings banks,and 'to the date of decedent's death in all other cases;all bonds,postal savings,treasury certificates or notes and other evidence of in- .debtedness of the United States to the decedent;all obligations,whether by statute or agreement they are designated as tax free,of.the llntted States,or any state,or political Subdivision-Yhereof,or of any foreign country,which are owned at the time of death;all wearing apparel,jewelry,si~,:erware,pic- tures,books,works of art,household furniture,horses,carriages,automobiles,boats,and any and all other personal chattels of whatsoever kind'or nature,left by decedent,together with the fairly estimated market value thereof;all bonds and mQrtgages held by decedent and of all claims due and OWing decedent a.t the time of death,and all promissory notes or other instruments in writing for the payment of money of which decedent died possessed,of whatsoever nature,with interest thereon,if any,giVing the face value and .estimated fair market value thereof,and if such estimated fail"market value be less than the face value,it sets forth briefly the reasons for such depreciation 'as tQ each item;all moneys payable to the estate from life insurance polici'es carrieg by decedent;all annulty and endowment contracts the proceeds of which were payabl~upon the death of the decedent;and all the corporate stocks and dividends due·thereon and:unpaid as of the date of death,bonds and a'ccrued interest thereon to the date of dece- dent's death and'other investment securities owned by the decedent at the time of death,with the market value thereof at such time. J In the case of securities of close or family corporations,the values reported are as far as possible substantiated by financial statements of the corporations,showing the assets and liabilities thereof as of the'date of death.The schedule also sets forth the interest of decedent at the time of death in any co-partnership or business,and in support of the value of such interest there is annexed to. said schedule,financial statements showing the assets and liabilities of said co-partnership or business. A copy'of the co-partnership agreement,(if oral,a statement setting forth the nature of the agreement) together with a statement setting forth the character of the business,its location,and such other facts pertaining to the business as may be pertinent to a fair and just appraisal of the decedent's interest therein must be submitted.·It should also set forth in itemized form,'togeth~r ~ith t!J~fair'market value' thereof,any other property owned or bequeathed by the decedent at the time of death. The Schedule C attached hereto and made part hereof sets forth a true answer to each inqul.ry contained therein and in the case of transfers ofproperty,real or personal,within two :ye~rs of ,decedent's death,in contemplation of decedent's death,or intended to take effect in possession or ~nj·oYmeri.t at or after death,said schedule sets forth the nature and value of such property,to whom transferred,the relationship of the transferees to the decedent,the proportionate share received by each 'tr~~~fe~ee and all other facts of a pertinent nature regarding said trimsfet:s.In the case of transfers intended to take effect in possession or enjoyment at or after death,there is also attached to the schedule a co~y of the deed,trust agreement or other instrument creating the trust.Therl~.is also set forth in said schedule a list of all pr.operty,real and personal,with its value,which passes at decedent's death by virtue of the exercise by decedent,either individually.,or jointly with another,or any power of appoint- ment vested in decedent,either individually or jointly,by the Will,de'ed,or other instrument of another, With a cQPY of the instrument creating such power attached to the schedule. That Schedule D attached hereto and made part hereof sets forth the names and addresses of all persons beneficially interested in this estate at the time of decedent's death,the,nature of their res- pective interests,their relationship,if any,to the decedent,together with the ages at the time of decedent's death of all minors,annuitants and beneficiaries for life under decedent's Will.It also contains a statement shoWing which of the beneficiaries named in the decedent's w~~l,if any,died prior to decedent,the dates of their death,their issue,andthe relationship of such issue'to the beneficiary. That Schedule E attached heretoand'mad~a part hereof sets forth all property,real and per- sonal,owned by the decedent jointly with another or others,including intangible,standing in the name of the decedent and others,plus the date and place of record of instruments effecting the vestiture of real'estate and the date of acquisition of personalty,plus the nal)le,address and relationship,i~/l.ny, of co-owners to the decedent. ...'\'" That Schedule F attached hereto and made a part hereof sets forth fully and in detail all debts and deductions claimed for and on behalf of this decedent's estate,including funeral expenses paid; family exemption,where applicable;costs of administration of this estate;counsel fees and fudiciary's commissions paid or to be paid;cost expended for burial trusts,tombstones or gravemarkers,and reli- gious services,in consequence of the death of the decedent;debts and claims owing and unpaid at time of,'. death;taxes accrued charge.able for period prior to decedent's death,(except.those allowed under Section 651 of the Inheritance and Estate Tax Act);together with a statement of collateral pledged for obliga- tions,if any.It is agreed that the fiduciary will present proof of said claimed obligations upon re- quest,that if the amount actually paid in settlement of any fee,commission or debt is less than the estimated amount claiming and allowed,that the same will be reported to the Register of Wills,and that the amount'of tax assessed can be reassessed in accordance therewith. That the totals of the appropriate columns in Schedules "A","B","en,"E",and "F"as directed therein,. have been carried forward and properly registered in the Summary. Subscribed and sworn to before me this ~. ...............................................day of QG.:t::.Q.p..r;;.:t:19 9...~..~~. ,MARGA~~~~~I~~;~?o~~b;~~..~~¥..~.?!..~~.~o.~;..n.et!.~~;..~..;~.¥~Y..~~.~.~.WAl>t:lINGTO 1971''MyCom'mission Expires February 27,'(City or Town and State) NOTE:Before signing affidavit make sure all blank spaces in the affidavit and schedules annexed are filled in with details or the word "None",and in case the assets include rare and unlisted securities, securities of close or family corporations or an interest in any co-partnership or business,that the data and statements required under the paragraph above relating to Schedule "B"are attached._Also make certain that column #1 in the "Summary"has been properly completed as above-directed. / l' .-Rcc-s4 (1-64) ,COM~ONWEAI.TH OF PENNSYLVANIA DEPARTMENT OF REVENUE BUREAU OF COUNTY COLLECTIONS TRANSFER INHERITANCE TAX RESIDENT DECEDENT SCHEDULE "Au REAL PROPERTY Real property in Pennsylvania,with statement of mortgage encumbrances upon each parcel at death of dece- dent.Where property held as joint tenant or tenancy by entireties,report on Schedule "E".Property held by the decedent as tenant in common with another or others,should be identified as to quantum of interest and the estimated value should be that of the decedent's interest only. The real property located In the Commonwealth of Pennsylvania should be described by lot and block number,street.and street number,together wi th a general description ofthe property,with a reference to the record of the conveyance by which the decedent took title;If a farm state number of a. cres;also statement of mortgage encumbrances upon each parcel at death of decedent.Taxes,assessments,accrued interest on mortgages,etc.,are to be listed on Schedule "F"and must not be deducted from this schedule. (1) ASSESSED VALUE FOR YEAR OF DECEDENT'S DEATH (2) ESTIMATED MARKET VALUE (3) DEPARTMENT VALUATION CAUTION (Do not write In this space) 5,000.00 ~ 3,000.00 ~ Home Farm -Route 40,Buffalo Township, Washington County,Pa. Containing 170 Acres consisting of Mounts tract and Noble tract. Improvements consist of 2 story frame dwelling,2 story brick dwelling,2 frame barns,garages and other outbuildings. For legal description,see deed to William A.Schan dated September 16,1969 in Deed Book page ._Al,L/f7-'ott J[1t~,(7 96~iW..t House and tot -vilr~ge of Taylorstown,~ Blaine Township,Washington County,Pa.J4jO( See deed of Beulah Scott -Deed Book 998.(~.~ page 196.J ~57 --j 7()()(J·~r House and lot -Village of Taylorstown,n~v Blaine Township,Washington County,Pa.~~' See deed of Hazel Lyle -Deed Book 979~ page 221.~,~S~.:.fJf~{)().~)fCfO Undivided 1/2 interest in and to oil and ~ gas in and underlying Hodgens Farm in B~aine I '\I Township,Washington County,Pennsylvanl.a,__a~Y containing 251 Acres.See Deed Book 650 ~~,-. page 20. 40,000.00 5,0,00.00 Insert this total opposite "real property",Schedule "A"in the X X X X X "As Reported"column on the last page of this return.53,000.00 )I... RCC-81 (2-64) COMMONWEALTH OF PENNSYLVANIA DEPARTMENT OF REVENUE BUREAU OF COUNTY COLLECTIONS INHERITANCE TAX DIVISION NOTICE OF FILING OF APPRAISEMENT THEODORE M STINE QE}i:Jii:~&XU Administrator) IN YOUR REPLY PLEA8E REFER TO 37-114-3 ) In Re:Estate 0 f ~E~LL@!I!.AlZu;:;Au.Bu,E~TuHJ........I,SL'&-JKJ.JN.l.lQ",X~_ _____---=W.:.:A.:.:S~H~I~N~G::.;T~O~N:.l.___County - FHe No.63-68-663 Dear Mr.Stine: You are hereby notified that the original appraisement in the estate of El j zahetb S.Knox has been filed in the office of the Register of Wills qf Washington County on November 6 ,19..6.9.Said appraisement reflects the following valuations: RealEstate _--'-..J.5..J,3..,.,J.J0:.u0'.l..0t...-J"OJJ.O.L.--_ Personal Property 9~9~,~3~8~2~.~4~8~- Transfers --""Z~,JIlID.u8.....5:....•....;:;9uZ"--_ Total -...:.J1L....5.L5~,Ouu6..c8~4~O.L-_ As to such tax that is paid within three months from date of death,a five (5%)percent discount is allowable.As to any tax that remains unpaid after one year from date of death,interest at the rate of six (8%)percent per annum is charged. Any party in interest who is aggrieved by an appraisement may appeal therefrom as provided by law. Dat e __..J.:NuJoJ..JvlLJew.Jmwb.Ll,.S;ie..J.r---16L,~1.l...:L9.u6...:::l9~-_ DATE OF DEATH: Note:This is not a bill. April 25,1968 RCC-39 (5-66) COMMONWEALTH OF PENNSYLVANIA TRANSFER INHERITANCE TAX RESIDENT DECEDENT SUMMARY Estate of KNOX, (Last Name) ELIZABETH S. (First Name)(Initial) DATE OF DEATH 4-25-69 'FILE NO.63-68-663 REPORT OF INHERITANCE TAX APPRAISER I,the undersigned duly appointed Inheritance Tax Appraiser in and for the County of 'vashingtQn Pennsylvania,do respectfully report that I have appraised the real and personal property as reported in the foregoing return at the values set forth opposite each item in the last column to the right in Schedules "A","B", "C",and "E". Dated:__~1.bl.,;-=-O!oL6loL==.Y.6.J...9 _ 04-25-68 REPORT OF THE REGISTER OF WILLS I,the undersigned duly elected Register of Wills in and for County,Pennsylvania,do respect- fully report that I have allowed deductions in the amounts claimed by deponent,except as to those items where a greater or lesser amount is set forth in the last column to the right in Schedule "F",which greater or lesser amount represents the sum allowed as a deduction. Dated:_ REGISTER OF WILLS INVENTORY Real Property (Schedule A) Personal Property (Schedule B) Transfers (Schedule C) Joint-Held Property (Schedule E) TOTAL GROSS ASSETS Less Debts and Deductions (SCHEDULE F) CLEAR VALUE OF ESTATE VALUE AS REAPPRAISED $-------+-- Valuation of life estates or $ t= $ $ t= $ (*)As evidenced by Charitable Exemption Certificates issued by the Secretary of Revenue. COMPUTATION OF TAX $------~-­$--------+--- $------~-- $------+-- $-------~-- $======= $====~$------ ___----JL- TOTAL TAX BALANCE :----'----l~ PAID $....JL BALANCE OF INHERITANCE TAX DUE Add interest at rate of 6%from_____to _ AMOUNT OF ESTATE TAX ASSESSED $--__- Estate tax paid $__~__--i BALANCE DUE Add interest at rate of 6%from -------(to----- Less tax previously paid BALANCE Less 5%of tax if paid within 3 months after death FOR USE OF REGISTER ONLY Tax on $~--2% Tax on $~--6% Tax on $--------~--5% Tax on $~--1 Tax on $~---I,'__J15% Exemptions * Total Estate ------l-__ TOTAL TAX FOR USE OF REGISTER ONLY ADjUSTMENTS NOTE:Where subsequent adjustments are made to the above computation of tax by the Register of Wills,for proper reason, same should be noted below,with short explanation. IL -----=~-------------------- Will (...No.Administration IN THE Year . MATTER OF THE APPRAISEMENT OF THE ESTATE OF ELIZABETH S.KNOM Deceased Late of ....BUFEALOTWP •.. County of WASHINGTON ... Commonwealth of Pennsylvania REPORT AND APPRAISAL Lt FonnJlCC-2 <.COMMONWEALTH OF PENNSYLVANIA DATE .............N9...Y..~.mb..~..r........Q..,.......l9..§9.....'.DEPAR'1!MENT OF BEVENUE •..RESIDENT INHERITANCE TAX COUNTY ..................J~~.~.h.:t..~.g.~.2 ..~...BUREAU OF COUNTY COLLECTIONS ................... I'APPRAISEMENT FILE NO.................§J.::..Q.e...::..§..Ql.............I HARRISBURG.PENNA.17127,.................. Whereas,....................................El.i~a.be.t.h ....s........Knox.........................................Jate of ..........................Bu.f.falo......T.w.p...................................... in the County of .................................Washingt.o.n.............................................................Commonwealth of Pennsylvania,having died on the ........................................Z.s.......t..h...................................day of .................A.p.r.i.l........................................19...6.8.,seized and possessed of an estate subject to Inheritance Tax under the laws of the Commonwealth of Pennsylvania; Therefore,I,...........................W.•.R........Chan.e.y............................................................,an appraiser duly appointed according to law, having been designated to make a fair and conscionable appraisement of the said estate,and to assess and fix the cash value of all annuities and life estates growing out of said estate,hereby file the following appraisement: In the event that any future interest in this estate is transferred in possession or enjoyment to collateral heirs of the decedent after the expiration of any estate for Ufe or for years,the Commonwealth hereby expressly reserves the right to appraise and assess transferinheritancetaxesatthelawfulcollateralrateonanysuchfutureinterest. Unit AppraisementDescriptionofAssetValuesMadeforInheritanceTaxPurpoles $ J!EALTY: See copy of Schedule "A"Attached 53,00b 00 PERSONALTY': See copy of nU.lUIU Schedule tT Btl attached 99,38~48 TRANSFERS: See cony of Scheduel ttett Attached 2,68~92 I I 'rnr;ll lC;C;M IA .1(1 J \ form~v~hbl::::~~w~~~~~L~::~a~o~e~..~~~~k~~t~~:;:e~p~r.;~~~m¥e~~~ ~?i~':':./W..........................~....~..(~~·::;·::Z~~~·)....................·....·.........,Penna. ·····················~'lASHINGTON······················.County RESIDENT INHERITANCE TAX APPRAISEMENT Estate of ....ELI.ZABETH S..•...KNOX . Deceased. Lu'te of ............nvFFALO Tlv.P .. Date of Death,Apr.i.l Z..5.,1.9..6.8 .. Appraisemel!t Docket Vol.,.3.7 .. Page,114..".,.3.No 6.3.~.6.8.~.6..6.3.. Filed in Register's Office,Nov.ember.619 6.9 Amount of tax due,$. DEPARTMENT OF REVENUE Received, Exa.mined and Approved,: . Wrote abaut Appra.isement, Appeal f1'om Appraisement,.. Entered and charged,.. , -. '"-~ /•. ),- Form !IllC,C ·10-.\.,r F''',-",,-..J OFFICE OF TM,E REGISTER OF WILLS OF --<~~rifl\A,..e-S£lH",=I~N~GJ.::IT.:l.:O~~~t _COUNTY AND AGENT OF THE COMMONWEALTH STATEMENT OF DEBTS AND DEDUCTIONS /O~7-//¥~ DEDUCTIONS ALLOWED IN THE SUM OF $t:Zrq'l/~ D"'z::Jt~ Regist.r of Wills,Agenl :#- ,- ESTATE OF __E_L_I_Z_A_B_E_T_H---=S~._K_N~O~X::.....-_LATE OF _B_u_f_f-:.a:.-1_o_T_o.:..w=n:.=s~h=i~p,--_ DATE OF FILING APPRAISEMENT DATE OF DEATH _..l>A..!>,Ip~r;..=i-=1~2:..:5~,--=1~9~6!...!8:1.__ DATE NO.OF NAM"OF PAYEE REMARKS VOUCH""AMOUNT 19 I>8 Custodian of house durl,ng MaY 11 Lillian Harshman ---.,-ao.miI:l.istration 525 00 ILabor tor care ot cattJ.e, T 'IV Ke11ev Ipreparing for auction,etc.983 19 1 R Jadwica Vezie Nursing decedent 105 00 Rl;7:::l'ho+hH",rr ""75 00 :n.1 t:hprl 'R Phillios ""168 75 Mrs.Louise A.Burns ""112 50--- curtis Pharmacv Account due 5 65 George E.Mumper Agency Insurance 284.00 /f\qT~,.;_...-'"'":1::.(1 (I,00 McVehi1 Plumbing Co.Account due 36 03 Bell Te1eohone Co.""30 87 wP~t Penn Pnwer Co.""90 86 Cn1umbirl Gas of Penna.""76 40 21:)Brownlee Funeral Home Burial expense .2701 50 PrlU]C ~noke.V.M.D.veterinarian for cattle 5 eo n.rrnt.r Tn <::11 Aqencv.Inc Administrator bond premium 260 00.'.-Labor for moving household ....n ~-"l;1 'R Millo....-1:".......;-+"....0 -<,71:: .Tnnp 1 Walter Grose Market Account due 3 20 1 ,"P-"l Dent of Revenue Car title transfer 1 00 27 Mary S.Crothers,ColI.1968 Road taxes 33 38 Charlotte Wallace,ColI.1968 Road taxes 22 23 Julv 13 Donald Hodgens A~?::~}sal fee-household 40 00 27 Malcolm Morgan,Treas.1968 .,..118 34Co.County,tax .. Auq.30 McWreath Dairy Account due 3 00 Sept.13 Richard Kelly Moving expense 20 00 18 Michael Pattison Labor 12 00 .--(Continued pn-.hack)- COMMONWEALTH OF PENNSYLVANIA COUNTY OF WASHINGTON I,Theodore M ~ti ne MY KNOWLI!:DGE AND BELIEF.THI!:FOREGOING ISA JUST AND TRU E srATEMENT OF DEBTS ADMINISTRATION SUBMITTED TO THE ESTJ\TE OF Elizabeth S.Knox' INHERITANCE TAX PURPOSES.~ SWORN AND SUBSCRIBED BEFORE ME THIS I (J d )DAY OF, 0~:------..JL.U,..1.¥-~+-~~'-III 20..- My Commission Expires February 27,1971" HEREBY CERTIFY.THAT.TO THE BEaT OF FUNERAL EXPENSES AND EXPENSES OF DECEASED.AS DEDUCTIONli FOR~(L.S.) 1 9 6 8 (continued) Sept.24 ".Charlotte Wallace,Tax ColI.1968 School tax 157.39 20 Oct.17 Mary S.Crothers,ColI. Nichles Bakery McKean Plumbing Co. Howard Mounts 1968 School tax Account due Plumbing repairs - Route 40 house Electric repair - Route 40 house 262.22 3.50 ~ -6,&19. 12 16 28 Nov.8 15 Dec.6 196 9 Feb.20 Mar.6 ~28 Apr.14 29 May 9 17 June 21 James R.Pitcairn,Inc. Hapchuck sanitary'-·S·e'rvice·· William Scott Iiapchuck Sanitary Service George E.Mumper Agency Julian I.Fine Coen Oil Co. Simon White's Sons .~.,....'.~ Gay+ord Miller Gale R.Miller Int.Revenue Service George E.Mumper Agency Observer Publishing Co. Arrow Insurance Agency Hapchuck Sanitary Service Mellon Bank Internal Revenue Service Charlotte Wallace,ColI. Repairs-Rt.40 house ~Q. Cl~aning septic tank- Route 40 house . _4Q.QQ- ,'"I. Repair barn-Rt.40 house~·e- It .••~l ~j Repair septic tank~ Route 40 house ..".."..2 50..A0.. Liab.insurance - Taylorstown 17.00 Appraisal-real estate 250.00 Sink-Taylorstown house .J4 4.B. Marker 160.00 Hauling water for Taylorstown house JQ_~ i-,,- SlAG -Taylorstown house .J 4 R.:l 1968 Income Tax 126.26 Fire ins.premo 156.00 refund .109.00 '47 .00 Advertise grant letters 12.50 Administrat~r b~nd ,prem.260.00 Clean septic tank- Rt.40 house ~5 g(J.. Safe deposit box rent 4.00 Addl.income tax-1968 9.56 1969 Road tax ~2.2~ ~~ry S.crothe~s,ColI.J,_1969 Road ~tax....~~'"'••>0'r _....4~~. Malcolm L.Morgan,Co.Treas. Gale R.Miller 1969 County tax Paint-Taylorstown house ~- (continued) ~~.-:\.....\ 'vw........ r.,,"":'. ..Form~~C'lO.~f ~.,C" OFFICE OF THE REGISTER OF WILLS WASHINGTONOF COUNTY PAGE.#2 CONTINUED STATEMENT OF DEBTS AND DEDUCTIONS DEDUCTIONS ALLOWED IN THE SUM OF $ . DATE APPROVED ..•....• AND AGENT OF THE COMMONWEALTH Register of Wills,Agent ESTATE OF _-=E~L:.::I:.:Z~A.::B~E::.;T::.:H:.:...-S~.---=..:K:::.;N:..::O:.:::X=--_LATE OF __B_u_f_f_a_l_o_T_o_w_n_s_h_,_i=-p _ DATE OF FILING APPRAISEMENT DATE OF DEATH March 25 ,1968 I=====;====r==============;:=============:r===== DATE NO.OF VOUCH"" NAME OF PAyEE REMARKS AMOUNT 19 .~.9 June 21 McKean Plumbing Co"Plumbip9 repair -Rt.40 hou~e ~bO" Auq.6 Mary S.Crothers,ColI.1969 School tax ,---3'9-~ j~nn,..,,. ROO 00 2400 00 ?n nn ""~--. ~v ......,. 17 00 , -UJ JV 1 I ~nn , 160 00 ~-- ~non 00..-,~~- 4 00 1..UU 1 ()0 ""'v.vv 12.50 d-f/"lr. "" Short certl.fl.cate 1969 Income tax 1969 Income Tax Lock box rental Addl.bond premium on sale of real estate Space heater Public liab.insurance J:'...V,lJCl_,-'-'-'0_.... Advertise letters .....'c j ,"t "'," Broker's cornrnissien PlUmbing repai,..r-~t,.AO .hou$p JJeIl.Cl.entiy assessment Federal Estate Tax ......'~~ ]:.f C;ont:>l .'"l.l::L u ... Washington Co.Reps. Register of Wl.lls """ \I .- H;ll~Realtv Mellon Bank Internal Revenue.Se.rvice July 1 /"l,,+-?Q Internal Revenue Service 1968--,. ,- Georae Mumper Aqencv C'---- Coen Oil Co. William Scott 'J.VIay u 16 Transfer taxes on sale of r~al estate tcrWJ.lliam ~. C"......u C;ono1 Internal Revenue Service Federal Estate Tax Tntl"'rn~l Revenue Service ~h~rlotte A.Wallace.ColI 1969 School tax 17 20 ?? oct. Sep Nov 3 I c. ?? 1 9 7 0." ,c:;. lh May 15 .T".... 1969-----i----t---t----'iffi~=,--,--------------4-;;~,.,..·-t-i7'l"l.,.-~rh:r_'m-:.......,~'!:r't---~----+--Aug.f I -••,__rl::l..LL..Luu::;a.Ll:uJ..L·l:d.L Sep.23 ~•.L ....-:>""""." " " """ estate Sht.certificate '[;1.;-,.;....,....; ''''-,-.z. Jlnmini ..'hnn'" premium 10.00 1.00 .''0'.f\f\ ...~ .--11 ' 59 50 260 00 COMMONWEALTH OF f'E":l!;'lS.rLVANIA,";-.:.:.~},,1: -S8:COUNTY OF _ r-•.~,.\.\"1.\ {':-1 I,-------------------__~HEREBY CERTIFY,THAT.TO THE BEar OF ~y KNOWLEDGE AND BELIEF,THE FOREGOING ISA JUST AND TRUE STATEMENT OF DEBTS.FUNERAL EXPENSES AND EXPEN8ES OF ADMINISTRATION SUBMITTED TO THE EST"TE OF ~.)•t . DEC.....S.,fD.AS DEDUCTIONS FOR INHERITANCE TAX PURPOSES._~~(L.5.) SWORN AND SUBSCRIBED BEFORE ME THIS _.....,....DAY OF _________~":.:.._III __ 1970 June Russell Marino,Agent Margaret Bails Sherman H.Siegel Theodore M.Stine Russell Marino,Register Penna.Estate tax Notary fees Bal.counsel fees Administrator's fees Filing this Account ~4~- 10.00 4875.00 8907.20 20.00 ~J~FoevtiIC~r '<J-.~-vf--&4'- LO~~ Total .- ~::~.7P'!tQ- Ito vv ' /~6:p.(} ftl"aeJ ;;~\:- - :~(~..,~ '.l'~,.. ;2 7f()91'13 ~ {:':'I i ~~:n l·.....·4-.V; ;70 JUt 10 PH 3 03 RUS SELL 1.IMU NO REGISTER OF WILLS WASHINGTON CO.,PA. .' .. .RCC-35 COMMONWEALTH OF PENNSYLVANIA TRANSFER INHERITANCE TAX RESIDENT DECEDENT SCHEDULE "n" PERSONAL PROPERTY INSTRUCTIONS:This Schedule must disclose all tangible and intangible personal property owned individually by the decedent,at the time of his death.Property owned by the decedent jointly with another or others must be listed under Schedule "E".Inta~gible personal property,titled in the name of the decedent,but payable at death to another or others,including but not limited to P.O.D.U.S.Savings Bonds and tenta- tive trust accounts,must be listed,despite the fact that they are not of the administered estate. Tangible personal property should be listed first (e.g.jewelry,wearing apparel,household goods,and fUrnishings,books,paintings,automobiles,boats,etc.) Intangible personal property,such as bonds,treasury certificates,cash on hand and in bank,.. stocks,'mortgages,notes,together with accrued interest or dividends,salaries or wages,insurance pay- able to the estate or fiduciary in said capacity,partnership interests,interest in any undistributed estate or or income from any property held in trust under the will or agreement of another,even though located outside of the State,at the time of death,should be listed in this schedule. Item No. ITEM List and describe fully UNIT ESTIMATED VALUE MARKET VALUE DEPARTMENT VALUATION (Do not write in this space) 1.Mellon National Bank &Trust Co. (Claysville Branch)checking account 2.Mellon National Bank &Trust Co. (Washington Branch)savings account 3.Mellon National Bank &Trust Co.-Saving Certificate #02381 4.Mellon National Bank &Trust Co.-Saving certificate #2158 5.Mellon National Bank &Trust Co.-Saving certificate #2157 6.Mellon National Bank &Trust Co.-Saving Certificate #14284 7.United States Savings Bonds -Series H: 2087.93 1000.00. 5000.00 10000.00 5000.00 ~. 10 -$1000 face amount 4 -$5000 face amount $10,000.0 20,000.0 30000.00 8.Internal Revenue Service -refund 9.John M.Stanley -account due 10.Household furniture 11.Proceeds auction sale -cattle and farm equipment 12.Packard Sedan (1955) 13.Interest in estate of decedent (husband- Thomas E.Knox): 20.00 100.00 1583.00 1621.75 200.00 Legacy 1/2 residue (estate) $10,000.0 20,000.0 30000.00 Insert this total opposite "Personal Property",Schedule "B"in the "As Reported"column on the last page of this return. x X 99382.48 Rcc-36 comroN1vEALTH OF PENNSYLVANIA Tfu~NSl~R INHERITANCE TAX ~~SIDENT DECEDENT SCHEDULE "c" TRANSFERS (1)Did decedent,within two years of death,make any transfer of any material part of his estate,without receiving a valuable and adequate consideration therefor?(Answer yes or no)No (2)Did decedent,within two years of death,transfer property from himself to himself and another or others (including a spouse)in joint ownership?(Answer yes or no)........~""JO.....--- (3)If the answer to (1)or (2)above is in the affirmative state: (a)Age of decedent at time of transfer _ (b)State of decedent's health at time of making the transfer.(Note 1). (c)Cause of decedent's death.(Note 1). (4)Did decedent,in his lifetime,make any transfer of property without receiving a valuable or adequate consideration therefor which was to take effect in possession or enjoyment at or after his death? (Answer yes or no)Yes -see tentative trust savings account listed below. (a)Was there any possibility that the property transferred might return to transferer or his estate or be subject to his power of disposition?(Answer yes or no)yes (b)What was the transferee's age at time of decedent's death?_ (5)Did decedent in his lifetime make any transfer without receiving a valuable and adequate consideration therefor under which transferor expressly or impliedly reserves for his life or any period which does not in fact end before his death: (a)The possession or enjoyment of or the right to income from the property transferred? (Answer yes or no)No (b)The right to designate the persons who shall possess or enjoy the property transferred or income therefrom?(Answer yes or no)~N~O~_ (6)If the answer to (5)(b)above is in the affirmative,state whether the right was reserved in decedent alone or others _ (7)Did decedent in his lifetime make a transfer,the consideration for which was transferee's promise to pay income to or for the benefit of care of transferor?(Answer yes or no)~N~o~__ (8)Did decedent,at any time,transfer property,the beneficial enjoyment of which was subject to change, because of a reserved power to alter,amend,or revoke,or which could revert to decedent under terms of transfer or by operation of law?(Answer yes or no)Yes (9)If the answer to (8)above is in the affirmative,was the power to alter,amend,or revoke the inter- est of the beneficiary reserved in the decedent alone or the decedent and others? (Answer yes or no)Deceaent alone. NOTE 1:The answers to these questions should be supported by affidavit by t~e attending physician as well as a copy of the death certificate. NOTE 2:If answer to any of the above questions is yes,set forth below a description of the property transferred,it's fair market value at date of death,dates of transfers and to whom transferred,with relationship of transferees to decedent,if any.Submit copy of any trust deed or instrument,if trans- fers are claimed to be non-taxable,also submit detailed statement of facts on which said claim is based. NOTE 3:List applicable property below in manner in which provided in Schedules A,B,or E. ITEM DESCRIPTION MARKET VALVE (Estimated)DEPT.VALUATION (Dept.Only) 1.Savings Account #187-36-8707.03 Mellon National Bank &Trust Co.(Claysville Branch)n/o Elizabeth S.Knox,Trustee for W.P.Stine 2685.92 ~~'.'. ,/,;;- { Insert this total opposite "Transfers",Schedule "C"in the "As Reported"column on the last page of this return. 2685.92 RCC-38 COMMONWEALTH OF PENNSYLVANIA TRANSFER INHERITANCE TAX RESIDENT DECEDENT SCHEDULE "E" JOINTLY OWNED PROPERTY INSTRUCTIONS:This schedule must disclose all property,real and personal,owned by the decedent jointly with another or others,including intangibles,standing in the name of the decedent and others.List real estate first,as entireties,or joint tenants,giving brief description,as indicated under Schedule "A",plus the date and place of record of instrument effecting vestiture,but do not include entireties or out of state real estate value in estate valuation column.Personal property should be listed as in Schedule "B",plus date of acquisition,and the name,address and relationship (if any)of co-owners to the decedent. DescriP.tiOn of Property,Date of Acquisition,Name Iunit Address and Relationship of Co-Owners,and Place Value of Record of Instrument,where Real Estate.! percentage Share Estate Valuation DEPARTMENT VALUATION CAUTION~Do not Write In This Space. NON E Insert this total opposite "Jointly Owned Property",Schedule "E" in the "As Reported"column on the last page of this return. Value of Entire Property NONE Value of Decedent's Interest RCC-37 (12-63) COMMONWEALTH OF PENNSYYLANIA TRANSFER INHERITANCE TAX RESIDENT DECEDENT SCHEDULE "D" BENEFICIARIES BENEFICIARIES AND ADDRESSES RELATIONSHIP SURVIVED(If step-children or DATE INTEREST OFStatefullnamesandaddressesofallwhoillegitimatechildrenDECEDENTOFBENEFICIARY ave an interest,vested,contingent or other-are involved,set STATE YES IN ESTATE wise,in estate)forth this fact.)OR NO BIRTH Wllllam P.Stlne One-half re!=:idueoakmontPennsvlvaniaBrotherves- 'l'neoaore J.V!.::S'Clne '1'",u1 "';'rcd-nT.Tn ',P~nnc::ulu",n;::l ,1\T .1."'7~C::()n~_h",l-F 'r~C!;rlll~-.. Deponent further says that all the above-named beneficiaries are living at this time except below: NAME DATE OF DEATH RESIDENCE OF THE Deceased ~IATIER OF THE APPRAISEMENT (Executor-Administrator must complete "As Reported"column #1.) GJ ~'"t:l ~......Cb Cb0ll)...e.til ::s til til til 0......::s '"t:l~Cb e.......0ll)til~'"t:l '0ll)(\)C"'...... ~0 ~'0 ~(\)...,....til '<...ll)...(\) ':' en.c:: ~~. :>~ W en en >< (')(')?"?"?"n ca ~~:::-- }\\--\----- Year . REPORT AND APPRAISAL Buffalo Township~~~... Commonwealth of Pennsylvania County of ~Cl~hington.......................__. Will ~N Administration ~o. IN THE ESTATE OF ELIZABETH S.KNOX a/k/a MRS.THOS.E. KNOX and MRS.THOMAS E.KNOX ·'Vd "·to D iNOl'eMHH SV.iA Sll:tfAlJ D 'B31Sr~313 ()itntf'lt"J,11J ":}Sina "*~ ~t.n :U1 '"!!':0 C) .00.. it:.:0 -0~"*"* •\0 U1 >. I\J \o:W til ...:...~!:CO"\WO(\)-;:::cqoop'"g- U1 1\,):0 ........•:.•{"C u:i ~.o 0.. ~oo'o- "*.~.-0 "*"'*"* Ll £Ud £2 IJD 694 ""SHERMAN ~.SIEGEA1,'ji:~Uj[RJ 215 Wash~ngton~d aHi9"Jl Washington,Pennsylvania 15301 .. ~.... ",':~: ,~: ..C:l..•. :~: :~:.,. .~. Q: ~NJ:~~;,~~~u :r-..:V.:()('t."i)"'),J ",......--....:-",--0 ~l'.:J:\.).\.J:3-:<:'\.~.0 _..:':'::s.'(\~O ~.O.:...._,..c.. .('->'.'0.0 - Jr':·~~~*'......,.,......"''"l!''."\"":,-":','-',",'..~...,..""':" I RCC4 (8-68)......';;'<..~:;:",:~COMMONWEALTH OFPENNSVLVANIA:' DEPARTMENT OF REVENUE NO:ll 0851711 OFff,ICIA~.':RECEIPT •PENNSYLVANIA INHERIT~NCE;:AND~STATE,:TA>{;:;< $~ RECEIVED TWO HUNDRED SIXTY-SIX THEODORE M.STINE,ADMR. From:C/O ATTY.SHERMAN H.SIEGEL Address 215 WASHINGTON TRUST BUILDING I and 2%Tax on 42/100 representing Pennsylvania Inheritance or Estate Tax due from the following estate: $-------- -dollars WASHINGTON,PE~~SYLVANIA 15301 6%Tax on $$1111 File No.63-68-663 Date of Death 4-25-68 1 15%Tax on $$III Date of Payment June 16,1970 I $266.42NameofDecedentELIZABETHS.KNOX,aka etc. %Tax on $$1=1 Estate Tax,Act of May 7,1927 County \vASHINGTON I Remarks: TOTAL TAX CREDIT Less five percentum of tax if paid within three months after date of death Plus interest at the rate of __%from _ to _ $266.42 $~ $U $266.42 ~TOTAL AMOUNT PAIDSEAL 37-114-3 @OO~~~[K]ill[L NOTE:To be delivered to taxpayer Received by NOTE:In accepting the transfer inheritance tax on future estates,prior to the.death of the life tenant or tenant for years,as evidenced by this receipt,it is understood that the Commonwealth sha not be precluded or prevented from hereafter assessing additional inheritance tax at the death of th",~M Jll .cw>,../cq LA ~~III life tenant or tenant for years whenever it appears that such additional tax may be legally due and --=-,_.., collectible for any reason'whatsoever. ____.J Ul "'" If Ii) RESIDENT DECEDENTS File No.63-68-663 COMMONWEALTH OF PENNSYLVANIA OFFICIAL RECEIPT Transfer Inheritance and Estate Tax ~9FormRCC-4-RI-3-66 No.949033 Date July 25,19 68 Office REGISTER OF WILLS.WASHINGTON,Pa. WASHINGTON County,ss:Received from_------'T"'-'h""'-.l!:!e~0~d..."our'-'e""___M~.__"S~t...1.·...n....e'---_ (Executor,lkdm!lIttcf'il")QCj;XXQ~ofthe estate OLf ~E........L....I.....Z'"A::IoJBu.EIOLI..T.....H...........S.........._Ku.,uNLLO'-"XL..-_ who died April 25 ,19~~the sum of SEVENTEEN THOUSAND ONE HUNDRED and no/100 - -Dollars, being TRANSFER INHERITANCE TAX and/or ESTATE TAX due the Commonwealth as follows: NOTE:tI~accepting the transfer inheritance tax on future estates prior to the death of the life tenant or tenant for years,as evidenced by this receipt,it is understood that the Com- monwealth shall not be precluded or prevented from hereafter assessing additional inheritancetaxatthedeathofthelifetenantortenantforyearswheneveritappearsthatsuchadditionaltaxmaybelegallydueandcollectibleforanyreasonwhatsoever. ann n{\ 18.000.00 ~Register of Wills ~2f~ Total $17,100.00 .*As evidenced by Charitable Exemption Certificates issued by the Secretary of Revenue under Act of May 28,1956,P.L.1757,effective June 1,1957,as amended by Act No.381,approved fu1y IL 1957,and Act No.207,1961,Section 302. 37-114-3 $,------ $ $.T __ $,------ $ Computation of Tax Tax on $5%$ Tax on $10%$ Tax on $2%$ Tax on $On Account 15%$ Exemptions *$ Total Estate $ Total Tax $ Less Tax Previously Paid (if any)$ Balance $ Less five per centum of tax if paid within 3 months after date of death $ ~ncomp1ete I'A~ount of Estate Tax Assessed:under the Act of May 7,1927.$ Add interest at the rate of %' from, to $ .-.-1-... Valuation Valuation $i _ $------- Total $i _ $>------ Total ......n ®OOD(@3D~£[L Date' Date Real Estate Total Gross Assets Less Debts and Expenses of .,,Administration Personal Property Clear Value of Estate Valuation of Life Estates or Annuities Date 19__$,~,..--_ ________19__~$=========== Estate Tax'Assessments Dat 11"1 '"-e .4~__'1''--_--'-_ ""--19__!:$=========== Appraisements Made and Filed NOTE,To be delivered to taxpayer by Register of Wills MOORE BUSINESS FORMS,INC.,ELMIRA,N.Y. '-' •FORM RCC-4-RI TRANSFER INHERITANCE and/or ESTATE TAL . RESIDENT DECEDENTS... RECEIPT Docket 37 Page 114 I.ine:---'3w--__ I ELIZABETH S.KNOXEstateofJ.-_ omCE OF REGISTER OF WIUS WASHINGTON,_______________--lPa. Date:__--=-Ju.;.;.:1=y!...--2...:.5...L,__19~ SIGNED AND SEALED AS PROVIDED BY SECTION 1201.ACT APRIL 9.1929.P.L.'343 AS AMENDED BY ACT MAY 15.1945,P.Li)28 ;...., , 1 RUSSELL MARINO Register of Wills 1201 (g).Act of April 9.1929.P.L.343.as amended, viz:-"To receive from Registers of Wil1s all duplicate re- ceipts for taxes paid to them by executors or adminis- trators and to charge the Registers receiving the moneywiththeamountreceiptedfor.The original of each suchreceiptshallbesignedandsealedbytheRegisterofWil1sandtransmittedtotheexecutororadministrator,whereupon it shall be a proper voucher in the settlement of the estate.In no event shall the executor or adminis-trator be entitled to a credit in his account by theRegisterunlessthereceiptissosignedandsealedbytheRegisterofWills," Pil1 in below name and address of person to whom tax receipt is delivered: ATTY.SHERMAN H.SIEGEL 215 WASHINGTON TRUST BUILDING "~. ~....-q--.J ~;:r .:Cl"'"""-:t>rn :;0 C::l(fl 'C 1"'"""'-0_~r,::J:-(r,.._-((..-:.:(.()rt!-..-1.6-f~t:..r;)rn "--.J-~;0 "r.:J0c),..z 1'"1···3:--0 (")<~'~;::X 0 ............'.... ;-w..-...l""'.1,...".'-"--0 "'0:>(fl'l""'.1 .J;: L WASHINGTON,PENNSYLVANIA 15301 -'